You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
STK38L
Serine/threonine-protein kinase 38-like

Protein Classes
Protein Summary
Description
Involved in the regulation of structural processes in differentiating and mature neuronal cells.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000389032
  • ENSP00000373684
  • ENSG00000211455

Symbol
  • KIAA0965
  • NDR2
  • NDR2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.96
protein domain
0.92
transcription factor binding site profile
0.88
kinase perturbation
0.84
transcription factor perturbation
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.87   (req: < 5)
Gene RIFs: 11   (req: <= 3)
Antibodies: 223   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.87   (req: >= 5)
Gene RIFs: 11   (req: > 3)
Antibodies: 223   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (1)
1 – 1 of 1
CHEMBL388978
chemical structure image
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Protein-Protein Interactions (70)
1 – 10 of 70
MOB1B
Tbio
Family: Enzyme
Novelty: 0.17103193
p_int: 1
Score: 0.969
Data Source: BioPlex,STRINGDB
MOB2
Tbio
Family: Enzyme
Novelty: 0.03351955
p_int: 0.999999995
p_ni: 4e-9
p_wrong: 2e-9
Score: 0.942
Data Source: BioPlex,STRINGDB
MOB1A
Tbio
Family: Enzyme
Novelty: 0.0429382
p_int: 0.999999894
p_ni: 1.06e-7
Score: 0.972
Data Source: BioPlex,STRINGDB
PRPH
Tbio
Novelty: 0.33333333
p_int: 0.999978434
p_ni: 0.000021542
p_wrong: 2.4e-8
Score: 0.429
Data Source: BioPlex,STRINGDB
LAMTOR5
Tbio
Novelty: 0.00523099
p_int: 0.999509943
p_ni: 0.000490055
p_wrong: 2e-9
Data Source: BioPlex
SLC25A25
Tbio
Family: Transporter
Novelty: 0.03287047
p_int: 0.982126707
p_ni: 0.017873292
p_wrong: 1e-9
Score: 0.207
Data Source: BioPlex,STRINGDB
NDRG3
Tbio
Novelty: 0.08172796
Score: 0.908
Data Source: STRINGDB
NDRG2
Tbio
Novelty: 0.01206769
Score: 0.907
Data Source: STRINGDB
NDRG1
Tbio
Novelty: 0.00461958
Score: 0.907
Data Source: STRINGDB
S100B
Tchem
Novelty: 0.00038202
Score: 0.877
Data Source: STRINGDB
Publication Statistics
PubMed Score  18.87

PubMed score by year
PubTator Score  17.49

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MAMTAGTTTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETRQKKLEVAMEEEGLADEEKKLRRSQH
1-70
ARKETEFLRLKRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKSDMLEKEQVAHIRAERD
70-140
ILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFI
140-210
HRDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLA
210-280
YSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPI
280-350
SEKAKDLILRFCIDSENRIGNSGVEEIKGHPFFEGVDWEHIRERPAAIPIEIKSIDDTSNFDDFPESDIL
350-420
QPVPNTTEPDYKSKDWVFLNYTYKRFEGLTQRGSIPTYMKAGKL
420-464
MAMTAGTTTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETRQKKLEVAMEEEGLADEEKKLRRSQHARKETEFLRLKRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKSDMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFIHRDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPISEKAKDLILRFCIDSENRIGNSGVEEIKGHPFFEGVDWEHIRERPAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYKRFEGLTQRGSIPTYMKAGKL