You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RASD1
Dexamethasone-induced Ras-related protein 1

Protein Summary
Description
Small GTPase. Negatively regulates the transcription regulation activity of the APBB1/FE65-APP complex via its interaction with APBB1/FE65 (By similarity). This gene encodes a member of the Ras superfamily of small GTPases and is induced by dexamethasone. The encoded protein is an activator of G-protein signaling and acts as a direct nucleotide exchange factor for Gi-Go proteins. This protein interacts with the neuronal nitric oxide adaptor protein CAPON, and a nuclear adaptor protein FE65, which interacts with the Alzheimer's disease amyloid precursor protein. This gene may play a role in dexamethasone-induced alterations in cell morphology, growth and cell-extracellular matrix interactions. Epigenetic inactivation of this gene is closely correlated with resistance to dexamethasone in multiple myeloma cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Sep 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000225688
  • ENSP00000225688
  • ENSG00000108551
  • ENST00000579152
  • ENSP00000463388

Symbol
  • AGS1
  • DEXRAS1
  • AGS1
  • DEXRAS1
  • MGC:26290
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.91
PubMedID
0.9
gene perturbation
0.89
virus perturbation
0.76
small molecule perturbation
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 120.35   (req: < 5)
Gene RIFs: 15   (req: <= 3)
Antibodies: 65   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 120.35   (req: >= 5)
Gene RIFs: 15   (req: > 3)
Antibodies: 65   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (10)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (104)
1 – 10 of 104
NOS1AP
Tbio
Family: Enzyme
Novelty: 0.00708032
Score: 0.976
Data Source: STRINGDB
GNAI2
Tbio
Novelty: 0.04542644
Score: 0.917
Data Source: STRINGDB
GNAI1
Tbio
Novelty: 0.12575547
Score: 0.917
Data Source: STRINGDB
NOS1
Tchem
Family: Enzyme
Novelty: 0.00047449
Score: 0.913
Data Source: STRINGDB
GNAI3
Tbio
Novelty: 0.03936457
Score: 0.878
Data Source: STRINGDB
GNB1
Tbio
Novelty: 0.04716243
Score: 0.805
Data Source: STRINGDB
NR2F6
Tbio
Family: NR
Novelty: 0.02380073
Score: 0.78
Data Source: STRINGDB
GNB3
Tbio
Novelty: 0.0043523
Score: 0.708
Data Source: STRINGDB
GNB5
Tbio
Novelty: 0.01077999
Score: 0.704
Data Source: STRINGDB
GNB4
Tbio
Novelty: 0.1530232
Score: 0.7
Data Source: STRINGDB
Publication Statistics
PubMed Score  120.35

PubMed score by year
PubTator Score  39.12

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGE
1-70
VYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLRQQILDTKSCLKNKTKENVDVPL
70-140
VICGNKGDRDFYREVDQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVS
140-210
VQYCDVLHKKALRNKKLLRAGSGGGGGDPGDAFGIVAPFARRPSVHSDLMYIREKASAGSQAKDKERCVI
210-280
S
280-281
MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLRQQILDTKSCLKNKTKENVDVPLVICGNKGDRDFYREVDQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKALRNKKLLRAGSGGGGGDPGDAFGIVAPFARRPSVHSDLMYIREKASAGSQAKDKERCVIS