You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ANGPT4
Angiopoietin-4

Protein Summary
Description
Binds to TEK/TIE2, modulating ANGPT1 signaling. Can induce tyrosine phosphorylation of TEK/TIE2. Promotes endothelial cell survival, migration and angiogenesis. Angiopoietins are proteins with important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-protein kinase receptor. The mechanism by which they contribute to angiogenesis is thought to involve regulation of endothelial cell interactions with supporting perivascular cells. The protein encoded by this gene functions as an agonist and is an angiopoietin. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000381922
  • ENSP00000371347
  • ENSG00000101280

Symbol
  • ANG3
  • ANG4
  • ANG3
  • ANG4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.88
protein domain
0.73
gene perturbation
0.62
cell type or tissue
0.61
molecular function
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 20.3   (req: < 5)
Gene RIFs: 13   (req: <= 3)
Antibodies: 257   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 20.3   (req: >= 5)
Gene RIFs: 13   (req: > 3)
Antibodies: 257   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (353)
Cell surface interactions at the vascular wall (R-HSA-202733)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell surface interactions at the vascular wall
Reactome
Hemostasis
Reactome
Tie2 Signaling
Name
Explore in Pharos
Explore in Source
Cell surface interactions at the vascular wall
Hemostasis
Tie2 Signaling
Protein-Protein Interactions (36)
1 – 10 of 36
TEK
Tclin
Family: Kinase
Novelty: 0.00075841
Score: 0.978
Data Source: Reactome,STRINGDB
ANGPT1
Tbio
Novelty: 0.00129574
Score: 0.81
Data Source: STRINGDB
ANGPT2
Tbio
Novelty: 0.0014012
Score: 0.81
Data Source: STRINGDB
TIE1
Tchem
Family: Kinase
Novelty: 0.0033548
Score: 0.776
Data Source: STRINGDB
KDR
Tclin
Family: Kinase
Novelty: 0.00019671
Score: 0.72
Data Source: STRINGDB
FLT4
Tclin
Family: Kinase
Novelty: 0.00175479
Score: 0.718
Data Source: STRINGDB
FLT1
Tclin
Family: Kinase
Novelty: 0.00037168
Score: 0.716
Data Source: STRINGDB
PDGFRB
Tclin
Family: Kinase
Novelty: 0.00115144
Score: 0.681
Data Source: STRINGDB
VPS51
Tbio
Novelty: 0.04491738
Score: 0.652
Data Source: STRINGDB
MET
Tclin
Family: Kinase
Novelty: 0.00040613
Score: 0.631
Data Source: STRINGDB
Publication Statistics
PubMed Score  20.30

PubMed score by year
PubTator Score  44.54

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLSQLAMLQGSLLLVVATMSVAQQTRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQR
1-70
ESLANPLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTILRSKLEQVQQQMAQNQTAPMLELGTSLLN
70-140
QTTAQIRKLTDMEAQLLNQTSRMDAQMPETFLSTNKLENQLLLQRQKLQQLQGQNSALEKRLQALETKQQ
140-210
EELASILSKKAKLLNTLSRQSAALTNIERGLRGVRHNSSLLQDQQHSLRQLLVLLRHLVQERANASAPAF
210-280
IMAGEQVFQDCAEIQRSGASASGVYTIQVSNATKPRKVFCDLQSSGGRWTLIQRRENGTVNFQRNWKDYK
280-350
QGFGDPAGEHWLGNEVVHQLTRRAAYSLRVELQDWEGHEAYAQYEHFHLGSENQLYRLSVVGYSGSAGRQ
350-420
SSLVLQNTSFSTLDSDNDHCLCKCAQVMSGGWWFDACGLSNLNGVYYHAPDNKYKMDGIRWHYFKGPSYS
420-490
LRASRMMIRPLDI
490-503
MLSQLAMLQGSLLLVVATMSVAQQTRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTILRSKLEQVQQQMAQNQTAPMLELGTSLLNQTTAQIRKLTDMEAQLLNQTSRMDAQMPETFLSTNKLENQLLLQRQKLQQLQGQNSALEKRLQALETKQQEELASILSKKAKLLNTLSRQSAALTNIERGLRGVRHNSSLLQDQQHSLRQLLVLLRHLVQERANASAPAFIMAGEQVFQDCAEIQRSGASASGVYTIQVSNATKPRKVFCDLQSSGGRWTLIQRRENGTVNFQRNWKDYKQGFGDPAGEHWLGNEVVHQLTRRAAYSLRVELQDWEGHEAYAQYEHFHLGSENQLYRLSVVGYSGSAGRQSSLVLQNTSFSTLDSDNDHCLCKCAQVMSGGWWFDACGLSNLNGVYYHAPDNKYKMDGIRWHYFKGPSYSLRASRMMIRPLDI