You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TCF19
Transcription factor 19

Protein Summary
Description
Potential trans-activating factor that could play an important role in the transcription of genes required for the later stages of cell cycle progression. This gene encodes a protein that contains a PHD-type zinc finger domain and likely functions as a transcription factor. The encoded protein plays a role proliferation and apoptosis of pancreatic beta cells. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.93
protein domain
0.92
trait
0.75
transcription factor perturbation
0.68
disease perturbation
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 8.68   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 201   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 8.68   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 201   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (130)
1 – 10 of 130
E2F6
Tbio
Family: TF
Novelty: 0.01340173
p_int: 0.997783909
p_ni: 0.002215847
p_wrong: 2.44e-7
Score: 0.183
Data Source: BioPlex,STRINGDB
MBD3
Tbio
Family: TF
Novelty: 0.09627139
p_int: 0.991817736
p_ni: 0.008182263
p_wrong: 1e-9
Score: 0.55
Data Source: BioPlex,STRINGDB
MTA3
Tbio
Family: TF
Novelty: 0.03342498
p_int: 0.99039916
p_ni: 0.00960084
Score: 0.768
Data Source: BioPlex,STRINGDB
MTA2
Tbio
Family: TF
Novelty: 0.02174723
p_int: 0.948762539
p_ni: 0.051237461
Score: 0.542
Data Source: BioPlex,STRINGDB
LIN9
Tbio
Novelty: 0.00193435
p_int: 0.942024653
p_ni: 0.057482106
p_wrong: 0.000493241
Score: 0.213
Data Source: BioPlex,STRINGDB
GATAD2B
Tbio
Family: TF
Novelty: 0.07240695
p_int: 0.871995434
p_ni: 0.128004566
Score: 0.673
Data Source: BioPlex,STRINGDB
MTA1
Tbio
Family: TF
Novelty: 0.00471326
p_int: 0.847607093
p_ni: 0.152392636
p_wrong: 2.71e-7
Score: 0.541
Data Source: BioPlex,STRINGDB
CCNB2
Tbio
Novelty: 0.01021878
Score: 0.898
Data Source: STRINGDB
CDC20
Tbio
Novelty: 0.00237728
Score: 0.897
Data Source: STRINGDB
CDCA8
Tbio
Novelty: 0.02218432
Score: 0.887
Data Source: STRINGDB
Publication Statistics
PubMed Score  8.68

PubMed score by year
PubTator Score  156.66

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLPCFQLLRIGGGRGGDLYTFHPPAGAGCTYRLGHRADLCDVALRPQQEPGLISGIHAELHAEPRGDDWR
1-70
VSLEDHSSQGTLVNNVRLPRGHRLELSDGDLLTFGPEGPPGTSPSEFYFMFQQVRVKPQDFAAITIPRSR
70-140
GEARVGAGFRPMLPSQGAPQRPLSTFSPAPKATLILNSIGSLSKLRPQPLTFSPSWGGPKSLPVPAPPGE
140-210
MGTTPSAPPQRNRRKSVHRVLAELDDESEPPENPPPVLMEPRKKLRVDKAPLTPTGNRRGRPRKYPVSAP
210-280
MAPPAVGGGEPCAAPCCCLPQEETVAWVQCDGCDVWFHVACVGCSIQAAREADFRCPGCRAGIQT
280-345
MLPCFQLLRIGGGRGGDLYTFHPPAGAGCTYRLGHRADLCDVALRPQQEPGLISGIHAELHAEPRGDDWRVSLEDHSSQGTLVNNVRLPRGHRLELSDGDLLTFGPEGPPGTSPSEFYFMFQQVRVKPQDFAAITIPRSRGEARVGAGFRPMLPSQGAPQRPLSTFSPAPKATLILNSIGSLSKLRPQPLTFSPSWGGPKSLPVPAPPGEMGTTPSAPPQRNRRKSVHRVLAELDDESEPPENPPPVLMEPRKKLRVDKAPLTPTGNRRGRPRKYPVSAPMAPPAVGGGEPCAAPCCCLPQEETVAWVQCDGCDVWFHVACVGCSIQAAREADFRCPGCRAGIQT