You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
AURKC
Aurora kinase C

Protein Summary
Description
Serine/threonine-protein kinase component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Plays also a role in meiosis and more particularly in spermatogenesis. Has redundant cellular functions with AURKB and can rescue an AURKB knockdown. Like AURKB, AURKC phosphorylates histone H3 at 'Ser-10' and 'Ser-28'. AURKC phosphorylates the CPC complex subunits BIRC5/survivin and INCENP leading to increased AURKC activity. Phosphorylates TACC1, another protein involved in cell division, at 'Ser-228'. This gene encodes a member of the Aurora subfamily of serine/threonine protein kinases. The encoded protein is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere proteins and may play a role in organizing microtubules ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000302804
  • ENSP00000302898
  • ENSG00000105146
  • ENST00000415300
  • ENSP00000407162
  • ENST00000598785
  • ENSP00000471830

Symbol
  • AIE2
  • AIK3
  • AIRK3
  • ARK3
  • STK13
  • AIE2
  • AIK3
  • ARK3
  • AurC
  • SPGF5
  • STK13
  • HEL-S-90
  • aurora-C
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.94
cellular component
0.81
small molecule
0.75
protein domain
0.73
tissue
0.63


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 110.96   (req: < 5)
Gene RIFs: 40   (req: <= 3)
Antibodies: 468   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 110.96   (req: >= 5)
Gene RIFs: 40   (req: > 3)
Antibodies: 468   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 31
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
axitinib
chemical structure image
Pathways (3)
Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
PathwayCommons: pid
Signaling by Aurora kinases
PathwayCommons: pid
Aurora B signaling
PathwayCommons: pid
Aurora C signaling
Name
Explore in Pharos
Explore in Source
Signaling by Aurora kinases
Aurora B signaling
Aurora C signaling
Protein-Protein Interactions (143)
1 – 10 of 143
MYH8
Tbio
Novelty: 0.01203725
p_int: 0.999992659
p_ni: 0.000007341
Score: 0.313
Data Source: BioPlex,STRINGDB
INCENP
Tbio
Novelty: 0.00902257
p_int: 0.999989338
p_ni: 0.000008903
p_wrong: 0.000001759
Score: 0.998
Data Source: BioPlex,STRINGDB
MYH1
Tbio
Novelty: 0.00659362
p_int: 0.999974673
p_ni: 0.000025321
p_wrong: 6e-9
Score: 0.313
Data Source: BioPlex,STRINGDB
HSP90AA4P
Tdark
p_int: 0.99996637
p_ni: 0.000033208
p_wrong: 4.22e-7
Data Source: BioPlex
HSP90AB3P
Tdark
p_int: 0.999947865
p_ni: 0.000052135
Data Source: BioPlex
MYH4
Tbio
Novelty: 0.00797522
p_int: 0.999937882
p_ni: 0.000062118
Score: 0.3
Data Source: BioPlex,STRINGDB
HSP90AA5P
Tdark
p_int: 0.998914745
p_ni: 0.001085255
Data Source: BioPlex
CUSTOS
Tdark
Novelty: 0.75
p_int: 0.998557528
p_ni: 0.001442347
p_wrong: 1.25e-7
Score: 0.188
Data Source: BioPlex,STRINGDB
USP19
Tbio
Family: Enzyme
Novelty: 0.04993065
p_int: 0.998263125
p_ni: 0.001736875
Score: 0.257
Data Source: BioPlex,STRINGDB
DHX38
Tbio
Family: Enzyme
Novelty: 0.02322174
p_int: 0.970154185
p_ni: 0.029737391
p_wrong: 0.000108424
Score: 0.163
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  110.96

PubMed score by year
PubTator Score  70.13

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVA
1-70
LKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDE
70-140
QRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEM
140-210
IEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLE
210-280
RLPLAQILKHPWVQAHSRRVLPPCAQMAS
280-309
MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPCAQMAS