Protein Classes
Protein Summary
Serine/threonine-protein kinase component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Plays also a role in meiosis and more particularly in spermatogenesis. Has redundant cellular functions with AURKB and can rescue an AURKB knockdown. Like AURKB, AURKC phosphorylates histone H3 at 'Ser-10' and 'Ser-28'. AURKC phosphorylates the CPC complex subunits BIRC5/survivin and INCENP leading to increased AURKC activity. Phosphorylates TACC1, another protein involved in cell division, at 'Ser-228'. This gene encodes a member of the Aurora subfamily of serine/threonine protein kinases. The encoded protein is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere proteins and may play a role in organizing microtubules ...more
- ENST00000302804
- ENSP00000302898
- ENSG00000105146
- ENST00000415300
- ENSP00000407162
- ENST00000598785
- ENSP00000471830
- AIE2
- AIK3
- AIRK3
- ARK3
- STK13
- AIE2
- AIK3
- ARK3
- AurC
- SPGF5
- STK13
- HEL-S-90
- aurora-C
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
|---|---|---|---|
molecular function | 0.94 | ||
cellular component | 0.81 | ||
small molecule | 0.75 | ||
protein domain | 0.73 | ||
tissue | 0.63 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 110.96 (req: < 5)
Gene RIFs: 40 (req: <= 3)
Antibodies: 468 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 110.96 (req: >= 5)
Gene RIFs: 40 (req: > 3)
Antibodies: 468 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 15
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligands: 31
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
Active Ligands (31)
1 – 10 of 31
Pathways (3)
PathwayCommons (3)
Items per page:
1 – 3 of 3
Data Source | Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|---|
PathwayCommons: pid | Signaling by Aurora kinases | ||||
PathwayCommons: pid | Aurora B signaling | ||||
PathwayCommons: pid | Aurora C signaling | ||||
Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|
Signaling by Aurora kinases | ||||
Aurora B signaling | ||||
Aurora C signaling | ||||
Gene Ontology Terms (24)
Functions (4)
Components (9)
Processes (11)
Items per page:
10
1 – 4 of 4
GO Term | Evidence | Assigned by | ||
|---|---|---|---|---|
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Traceable Author Statement (TAS) | UniProtKB | |||
Inferred from Electronic Annotation (IEA) | UniProtKB-KW | |||
Protein-Protein Interactions (143)
1 – 10 of 143
MYH8
Novelty: 0.01203725
p_int: 0.999992659
p_ni: 0.000007341
Score: 0.313
Data Source: BioPlex,STRINGDB
INCENP
Novelty: 0.00902257
p_int: 0.999989338
p_ni: 0.000008903
p_wrong: 0.000001759
Score: 0.998
Data Source: BioPlex,STRINGDB
MYH1
Novelty: 0.00659362
p_int: 0.999974673
p_ni: 0.000025321
p_wrong: 6e-9
Score: 0.313
Data Source: BioPlex,STRINGDB
HSP90AA4P
p_int: 0.99996637
p_ni: 0.000033208
p_wrong: 4.22e-7
Data Source: BioPlex
HSP90AB3P
p_int: 0.999947865
p_ni: 0.000052135
Data Source: BioPlex
MYH4
Novelty: 0.00797522
p_int: 0.999937882
p_ni: 0.000062118
Score: 0.3
Data Source: BioPlex,STRINGDB
HSP90AA5P
p_int: 0.998914745
p_ni: 0.001085255
Data Source: BioPlex
CUSTOS
Novelty: 0.75
p_int: 0.998557528
p_ni: 0.001442347
p_wrong: 1.25e-7
Score: 0.188
Data Source: BioPlex,STRINGDB
USP19
Family: Enzyme
Novelty: 0.04993065
p_int: 0.998263125
p_ni: 0.001736875
Score: 0.257
Data Source: BioPlex,STRINGDB
DHX38
Family: Enzyme
Novelty: 0.02322174
p_int: 0.970154185
p_ni: 0.029737391
p_wrong: 0.000108424
Score: 0.163
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score 110.96
PubMed score by year
PubTator Score 70.13
PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVA
1-70
LKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDE
70-140
QRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEM
140-210
IEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLE
210-280
RLPLAQILKHPWVQAHSRRVLPPCAQMAS
280-309
MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPCAQMAS
Find similar targets by: