You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NEU3
Sialidase-3

Protein Classes
Protein Summary
Description
Plays a role in modulating the ganglioside content of the lipid bilayer at the level of membrane-bound sialyl glycoconjugates. This gene product belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. It is localized in the plasma membrane, and its activity is specific for gangliosides. It may play a role in modulating the ganglioside content of the lipid bilayer. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000294064
  • ENSP00000294064
  • ENSG00000162139
  • ENST00000531509
  • ENSP00000432097

Symbol
  • SIAL3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.83
disease perturbation
0.79
pathway
0.73
gene perturbation
0.72
tissue
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 127.99   (req: < 5)
Gene RIFs: 42   (req: <= 3)
Antibodies: 66   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 127.99   (req: >= 5)
Gene RIFs: 42   (req: > 3)
Antibodies: 66   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (14)
Asparagine N-linked glycosylation (R-HSA-446203)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Asparagine N-linked glycosylation
Reactome
Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
Reactome
Glycosphingolipid metabolism
Reactome
Metabolism
Reactome
Metabolism of lipids
Name
Explore in Pharos
Explore in Source
Asparagine N-linked glycosylation
Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
Glycosphingolipid metabolism
Metabolism
Metabolism of lipids
Gene Ontology Terms (12)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Protein-Protein Interactions (63)
1 – 10 of 63
PLA2G10
Tchem
Family: Enzyme
Novelty: 0.00367717
p_int: 0.905327349
p_ni: 0.094672425
p_wrong: 2.26e-7
Score: 0.178
Data Source: BioPlex,STRINGDB
ALOX5
Tclin
Family: Enzyme
Novelty: 0.00071056
p_int: 0.776158586
p_ni: 0.223836312
p_wrong: 0.000005102
Score: 0.188
Data Source: BioPlex,STRINGDB
GLA
Tclin
Family: Enzyme
Novelty: 0.0006641
Score: 0.914
Data Source: STRINGDB
ARSA
Tbio
Family: Enzyme
Novelty: 0.00282267
Score: 0.913
Data Source: STRINGDB
GALC
Tbio
Family: Enzyme
Novelty: 0.00289873
Score: 0.91
Data Source: STRINGDB
GAL3ST1
Tbio
Family: Enzyme
Novelty: 0.03265137
Score: 0.908
Data Source: STRINGDB
UGT8
Tbio
Family: Enzyme
Novelty: 0.02351176
Score: 0.9
Data Source: STRINGDB
MCOLN1
Tchem
Family: IC
Novelty: 0.00275792
Score: 0.75
Data Source: STRINGDB
ST3GAL3
Tbio
Family: Enzyme
Novelty: 0.01534626
Score: 0.641
Data Source: STRINGDB
ST3GAL5
Tbio
Family: Enzyme
Novelty: 0.01099306
Score: 0.637
Data Source: STRINGDB
Publication Statistics
PubMed Score  127.99

PubMed score by year
PubTator Score  78.39

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEEVTTCSFNSPLFRQEDDRGITYRIPALLYIPPTHTFLAFAEKRSTRRDEDALHLVLRRGLRIGQLVQW
1-70
GPLKPLMEATLPGHRTMNPCPVWEQKSGCVFLFFICVRGHVTERQQIVSGRNAARLCFIYSQDAGCSWSE
70-140
VRDLTEEVIGSELKHWATFAVGPGHGIQLQSGRLVIPAYTYYIPSWFFCFQLPCKTRPHSLMIYSDDLGV
140-210
TWHHGRLIRPMVTVECEVAEVTGRAGHPVLYCSARTPNRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQ
210-280
GSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSESWLLYSHPTSRKQRVDLGIYLNQT
280-350
PLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFECGTKQECEQIAFRLFTHREILSHLQGDCTSPGR
350-420
NPSQFKSN
420-428
MEEVTTCSFNSPLFRQEDDRGITYRIPALLYIPPTHTFLAFAEKRSTRRDEDALHLVLRRGLRIGQLVQWGPLKPLMEATLPGHRTMNPCPVWEQKSGCVFLFFICVRGHVTERQQIVSGRNAARLCFIYSQDAGCSWSEVRDLTEEVIGSELKHWATFAVGPGHGIQLQSGRLVIPAYTYYIPSWFFCFQLPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVLYCSARTPNRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSESWLLYSHPTSRKQRVDLGIYLNQTPLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFECGTKQECEQIAFRLFTHREILSHLQGDCTSPGRNPSQFKSN