You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DHDH
Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase

Protein Summary
Description
This gene encodes an enzyme that belongs to the family of dihydrodiol dehydrogenases, which exist in multiple forms in mammalian tissues and are involved in the metabolism of xenobiotics and sugars. These enzymes catalyze the NADP1-linked oxidation of transdihydrodiols of aromatic hydrocarbons to corresponding catechols. This enzyme is a dimeric dihydrodiol dehydrogenase, and it differs from monomeric dihydrodiol dehydrogenases in its high substrate specificity for trans-dihydrodiols of aromatic hydrocarbons in the oxidative direction. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000221403
  • ENSP00000221403
  • ENSG00000104808

Symbol
  • 2DD
  • 2DD
  • HUM2DD
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.85
gene perturbation
0.59
cell type or tissue
0.56
cellular component
0.54
tissue sample
0.52


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 391.92   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 138   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 391.92   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 138   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
KEGG
Metabolic pathways
KEGG
Metabolism of xenobiotics by cytochrome P450
KEGG
Pentose and glucuronate interconversions
Name
Explore in Pharos
Explore in Source
Metabolic pathways
Metabolism of xenobiotics by cytochrome P450
Pentose and glucuronate interconversions
Protein-Protein Interactions (54)
1 – 10 of 54
AKR1C1
Tchem
Family: Enzyme
Novelty: 0.00543961
Score: 0.984
Data Source: STRINGDB
AKR1B1
Tclin
Family: Enzyme
Novelty: 0.00050572
Score: 0.96
Data Source: STRINGDB
AKR1B10
Tchem
Family: Enzyme
Novelty: 0.00276847
Score: 0.955
Data Source: STRINGDB
EPHX1
Tchem
Family: Enzyme
Novelty: 0.00210581
Score: 0.938
Data Source: STRINGDB
AKR1C2
Tchem
Family: Enzyme
Novelty: 0.00191717
Score: 0.924
Data Source: STRINGDB
AKR1C4
Tchem
Family: Enzyme
Novelty: 0.01254897
Score: 0.924
Data Source: STRINGDB
AKR1C3
Tchem
Family: Enzyme
Novelty: 0.00230684
Score: 0.862
Data Source: STRINGDB
DHRS9
Tbio
Family: Enzyme
Novelty: 0.00329747
Score: 0.804
Data Source: STRINGDB
AKR1E2
Tbio
Family: Enzyme
Novelty: 0.10704166
Score: 0.758
Data Source: STRINGDB
GALK2
Tbio
Family: Kinase
Novelty: 0.08591944
Score: 0.75
Data Source: STRINGDB
Publication Statistics
PubMed Score  391.92

PubMed score by year
PubTator Score  24.17

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSVEVA
1-70
YIGTQHPQHKAAVMLCLAAGKAVLCEKPTGVNAAEVREMVAEARSRALFLMEAIWTRFFPASEALRSVLA
70-140
QGTLGDLRVARAEFGKNLIHVPRAVDRAQAGGALLDIGIYCVQFTSMVFGGQKPEKISVVGRRHETGVDD
140-210
TVTVLLQYPGEVHGSFTCSITVQLSNTASVSGTKGMVQLLNPCWCPTELVVKGEHKEFPLPPVPKDCNFD
210-280
NGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEEVRKAIGVTFPQDKR
280-334
MALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSVEVAYIGTQHPQHKAAVMLCLAAGKAVLCEKPTGVNAAEVREMVAEARSRALFLMEAIWTRFFPASEALRSVLAQGTLGDLRVARAEFGKNLIHVPRAVDRAQAGGALLDIGIYCVQFTSMVFGGQKPEKISVVGRRHETGVDDTVTVLLQYPGEVHGSFTCSITVQLSNTASVSGTKGMVQLLNPCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEEVRKAIGVTFPQDKR