You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DOLK
Dolichol kinase

Protein Summary
Description
Involved in the synthesis of the sugar donor Dol-P-Man which is required in the synthesis of N-linked and O-linked oligosaccharides and for that of GPI anchors. The protein encoded by this gene catalyzes the CTP-mediated phosphorylation of dolichol, and is involved in the synthesis of Dol-P-Man, which is an essential glycosyl carrier lipid for C- and O-mannosylation, N- and O-linked glycosylation of proteins, and for the biosynthesis of glycosyl phosphatidylinositol anchors in endoplasmic reticulum. Mutations in this gene are associated with dolichol kinase deficiency.[provided by RefSeq, Apr 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000372586
  • ENSP00000361667
  • ENSG00000175283

Symbol
  • KIAA1094
  • TMEM15
  • DK
  • DK1
  • CDG1M
  • SEC59
  • TMEM15
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.98
kinase perturbation
0.91
histone modification site profile
0.9
virus perturbation
0.9
tissue sample
0.65


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 85.38   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 70   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 85.38   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 70   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (14)
Asparagine N-linked glycosylation (R-HSA-446203)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Asparagine N-linked glycosylation
Reactome
Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
Reactome
Defective DOLK causes DOLK-CDG (CDG-1m)
Reactome
Disease
Reactome
Diseases associated with glycosylation precursor biosynthesis
Name
Explore in Pharos
Explore in Source
Asparagine N-linked glycosylation
Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
Defective DOLK causes DOLK-CDG (CDG-1m)
Disease
Diseases associated with glycosylation precursor biosynthesis
Gene Ontology Terms (5)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (92)
1 – 10 of 92
OPALIN
Tdark
Novelty: 0.06813417
p_int: 0.999536341
p_ni: 0.000463026
p_wrong: 6.33e-7
Data Source: BioPlex
KCNA6
Tclin
Family: IC
p_int: 0.999343011
p_ni: 0.000528213
p_wrong: 0.000128776
Score: 0.234
Data Source: BioPlex,STRINGDB
TNFRSF1A
Tchem
Novelty: 0.00048442
p_int: 0.998829042
p_ni: 0.001084126
p_wrong: 0.000086833
Data Source: BioPlex
CD274
Tclin
Novelty: 0.00020953
p_int: 0.996846914
p_ni: 0.003124411
p_wrong: 0.000028675
Data Source: BioPlex
FPR2
Tchem
Family: GPCR
Novelty: 0.00286277
p_int: 0.996482621
p_ni: 0.003154789
p_wrong: 0.000362589
Data Source: BioPlex
ERGIC3
Tbio
Novelty: 0.15783642
p_int: 0.995591599
p_ni: 0.004345223
p_wrong: 0.000063178
Score: 0.154
Data Source: BioPlex,STRINGDB
KCNA5
Tclin
Family: IC
Novelty: 0.00228979
p_int: 0.991048698
p_ni: 0.000451902
p_wrong: 0.0084994
Data Source: BioPlex
TPRA1
Tdark
Family: GPCR
Novelty: 0.39628306
p_int: 0.966789374
p_ni: 0.025962657
p_wrong: 0.00724797
Score: 0.162
Data Source: BioPlex,STRINGDB
CACNG1
Tbio
Family: IC
Novelty: 0.174255
p_int: 0.96317979
p_ni: 0.027472301
p_wrong: 0.009347909
Data Source: BioPlex
APLNR
Tchem
Family: GPCR
Novelty: 0.001441
p_int: 0.96288607
p_ni: 0.035239602
p_wrong: 0.001874328
Data Source: BioPlex
Publication Statistics
PubMed Score  85.38

PubMed score by year
PubTator Score  7.64

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTRECPSPAPGPGAPLSGSVLAEAAVVFAVVLSIHATVWDRYSWCAVALAVQAFYVQYKWDRLLQQGSAV
1-70
FQFRMSANSGLLPASMVMPLLGLVMKERCQTAGNPFFERFGIVVAATGMAVALFSSVLALGITRPVPTNT
70-140
CVILGLAGGVIIYIMKHSLSVGEVIEVLEVLLIFVYLNMILLYLLPRCFTPGEALLVLGGISFVLNQLIK
140-210
RSLTLVESQGDPVDFFLLVVVVGMVLMGIFFSTLFVFMDSGTWASSIFFHLMTCVLSLGVVLPWLHRLIR
210-280
RNPLLWLLQFLFQTDTRIYLLAYWSLLATLACLVVLYQNAKRSSSESKKHQAPTIARKYFHLIVVATYIP
280-350
GIIFDRPLLYVAATVCLAVFIFLEYVRYFRIKPLGHTLRSFLSLFLDERDSGPLILTHIYLLLGMSLPIW
350-420
LIPRPCTQKGSLGGARALVPYAGVLAVGVGDTVASIFGSTMGEIRWPGTKKTFEGTMTSIFAQIISVALI
420-490
LIFDSGVDLNYSYAWILGSISTVSLLEAYTTQIDNLLLPLYLLILLMA
490-538
MTRECPSPAPGPGAPLSGSVLAEAAVVFAVVLSIHATVWDRYSWCAVALAVQAFYVQYKWDRLLQQGSAVFQFRMSANSGLLPASMVMPLLGLVMKERCQTAGNPFFERFGIVVAATGMAVALFSSVLALGITRPVPTNTCVILGLAGGVIIYIMKHSLSVGEVIEVLEVLLIFVYLNMILLYLLPRCFTPGEALLVLGGISFVLNQLIKRSLTLVESQGDPVDFFLLVVVVGMVLMGIFFSTLFVFMDSGTWASSIFFHLMTCVLSLGVVLPWLHRLIRRNPLLWLLQFLFQTDTRIYLLAYWSLLATLACLVVLYQNAKRSSSESKKHQAPTIARKYFHLIVVATYIPGIIFDRPLLYVAATVCLAVFIFLEYVRYFRIKPLGHTLRSFLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKGSLGGARALVPYAGVLAVGVGDTVASIFGSTMGEIRWPGTKKTFEGTMTSIFAQIISVALILIFDSGVDLNYSYAWILGSISTVSLLEAYTTQIDNLLLPLYLLILLMA