You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CYP8B1
7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase

Protein Summary
Description
Involved in bile acid synthesis and is responsible for the conversion of 7 alpha-hydroxy-4-cholesten-3-one into 7 alpha, 12 alpha-dihydroxy-4-cholesten-3-one. Responsible for the balance between formation of cholic acid and chenodeoxycholic acid. Has a rather broad substrate specificity including a number of 7-alpha-hydroxylated C27 steroids. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the conversion of 7 alpha-hydroxy-4-cholesten-3-one into 7-alpha,12-alpha-dihydroxy-4-cholesten-3-one. The balance between these two steroids determines the relative amounts of cholic acid and chenodeoxycholic acid both of which are secreted in the bile and affect the solubility of cholesterol. This gene is unique among the cytochrome P450 genes in that it is in ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000316161
  • ENSP00000318867
  • ENSG00000180432

Symbol
  • CYP12
  • CP8B
  • CYP12
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.97
molecular function
0.7
cell line
0.59
pathway
0.58
cellular component
0.55


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 42.91   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 191   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 42.91   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 191   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (44)
Arachidonic acid metabolism (R-HSA-2142753)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 21
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Arachidonic acid metabolism
Reactome
Bile acid and bile salt metabolism
Reactome
Biological oxidations
Reactome
Cytochrome P450 - arranged by substrate type
Reactome
Eicosanoids
Name
Explore in Pharos
Explore in Source
Arachidonic acid metabolism
Bile acid and bile salt metabolism
Biological oxidations
Cytochrome P450 - arranged by substrate type
Eicosanoids
Gene Ontology Terms (11)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (93)
1 – 10 of 93
TACSTD2
Tbio
Novelty: 0.00131172
p_int: 0.999947778
p_ni: 0.000052209
p_wrong: 1.3e-8
Score: 0.689
Data Source: BioPlex,STRINGDB
HSPA8
Tchem
Novelty: 0.00100906
p_int: 0.993939225
p_ni: 0.006060775
Data Source: BioPlex
HERC3
Tbio
Family: Enzyme
Novelty: 0.18068402
p_int: 0.960744849
p_ni: 0.039255151
Score: 0.192
Data Source: BioPlex,STRINGDB
GNB2
Tbio
Novelty: 0.20536996
p_int: 0.960016883
p_ni: 0.03997653
p_wrong: 0.000006587
Data Source: BioPlex
PTP4A2
Tchem
Family: Enzyme
Novelty: 0.00462335
p_int: 0.899308307
p_ni: 0.100562895
p_wrong: 0.000128798
Score: 0.187
Data Source: BioPlex,STRINGDB
HSD3B7
Tbio
Family: Enzyme
Novelty: 0.07665169
Score: 0.968
Data Source: STRINGDB
AKR1D1
Tbio
Family: Enzyme
Novelty: 0.01202209
Score: 0.955
Data Source: STRINGDB
NR1H4
Tclin
Family: NR
Novelty: 0.00083346
Score: 0.814
Data Source: STRINGDB
ABCB11
Tchem
Family: Transporter
Novelty: 0.00136209
Score: 0.811
Data Source: STRINGDB
SQLE
Tchem
Family: Enzyme
Novelty: 0.01030355
Score: 0.805
Data Source: STRINGDB
Publication Statistics
PubMed Score  42.91

PubMed score by year
PubTator Score  27.56

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVLWGPVLGALLVVIAGYLCLPGMLRQRRPWEPPLDKGTVPWLGHAMAFRKNMFEFLKRMRTKHGDVFTV
1-70
QLGGQYFTFVMDPLSFGSILKDTQRKLDFGQYAKKLVLKVFGYRSVQGDHEMIHSASTKHLRGDGLKDLN
70-140
ETMLDSLSFVMLTSKGWSLDASCWHEDSLFRFCYYILFTAGYLSLFGYTKDKEQDLLQAGELFMEFRKFD
140-210
LLFPRFVYSLLWPREWLEVGRLQRLFHKMLSVSHSQEKEGISNWLGNMLQFLREQGVPSAMQDKFNFMML
210-280
WASQGNTGPTSFWALLYLLKHPEAIRAVREEATQVLGEARLETKQSFAFKLGALQHTPVLDSVVEETLRL
280-350
RAAPTLLRLVHEDYTLKMSSGQEYLFRHGDILALFPYLSVHMDPDIHPEPTVFKYDRFLNPNGSRKVDFF
350-420
KTGKKIHHYTMPWGSGVSICPGRFFALSEVKLFILLMVTHFDLELVDPDTPLPHVDPQRWGFGTMQPSHD
420-490
VRFRYRLHPTE
490-501
MVLWGPVLGALLVVIAGYLCLPGMLRQRRPWEPPLDKGTVPWLGHAMAFRKNMFEFLKRMRTKHGDVFTVQLGGQYFTFVMDPLSFGSILKDTQRKLDFGQYAKKLVLKVFGYRSVQGDHEMIHSASTKHLRGDGLKDLNETMLDSLSFVMLTSKGWSLDASCWHEDSLFRFCYYILFTAGYLSLFGYTKDKEQDLLQAGELFMEFRKFDLLFPRFVYSLLWPREWLEVGRLQRLFHKMLSVSHSQEKEGISNWLGNMLQFLREQGVPSAMQDKFNFMMLWASQGNTGPTSFWALLYLLKHPEAIRAVREEATQVLGEARLETKQSFAFKLGALQHTPVLDSVVEETLRLRAAPTLLRLVHEDYTLKMSSGQEYLFRHGDILALFPYLSVHMDPDIHPEPTVFKYDRFLNPNGSRKVDFFKTGKKIHHYTMPWGSGVSICPGRFFALSEVKLFILLMVTHFDLELVDPDTPLPHVDPQRWGFGTMQPSHDVRFRYRLHPTE