You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ING4
Inhibitor of growth protein 4

Protein Summary
Description
Component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. Through chromatin acetylation it may function in DNA replication. May inhibit tumor progression by modulating the transcriptional output of signaling pathways which regulate cell proliferation. Can suppress brain tumor angiogenesis through transcriptional repression of RELA/NFKB3 target genes when complexed with RELA. May also specifically suppress loss of contact inhibition elicited by activated oncogenes such as MYC. Represses hypoxia inducible factor's (HIF) activity by interacting with HIF prolyl hydroxylase 2 (EGLN1). Can enhance apoptosis induced by serum starvation in mammary epithelial cell line HC11 (By similarity). This gene encodes a tumor suppressor protein that contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This protein can bind TP53 and ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000341550
  • ENSP00000343396
  • ENSG00000111653
  • ENST00000396807
  • ENSP00000380024
  • ENST00000412586
  • ENSP00000412705
  • ENST00000423703
  • ENSP00000414008
  • ENST00000444704
  • ENSP00000397343
  • ENST00000446105
  • ENSP00000415903

Symbol
  • my036
  • p29ING4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.97
kinase perturbation
0.96
histone modification site profile
0.92
transcription factor binding site profile
0.87
biological process
0.81


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 82.4   (req: < 5)
Gene RIFs: 71   (req: <= 3)
Antibodies: 255   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 82.4   (req: >= 5)
Gene RIFs: 71   (req: > 3)
Antibodies: 255   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (3)
Chromatin modifying enzymes (R-HSA-3247509)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Chromatin modifying enzymes
Reactome
Chromatin organization
Reactome
HATs acetylate histones
Name
Explore in Pharos
Explore in Source
Chromatin modifying enzymes
Chromatin organization
HATs acetylate histones
Protein-Protein Interactions (56)
1 – 10 of 56
JADE2
Tbio
Family: Epigenetic
Novelty: 0.47295209
p_int: 0.999999992
p_ni: 4e-9
p_wrong: 5e-9
Score: 0.995
Data Source: BioPlex,STRINGDB
MEAF6
Tbio
Novelty: 0.2575873
p_int: 0.999999987
p_ni: 1e-8
p_wrong: 3e-9
Score: 0.998
Data Source: BioPlex,Reactome,STRINGDB
KAT7
Tbio
Family: TF; Epigenetic
Novelty: 0.01943501
Score: 0.991
Data Source: Reactome,STRINGDB
JADE3
Tbio
Family: Epigenetic
Novelty: 0.69709544
Score: 0.977
Data Source: STRINGDB
JADE1
Tbio
Family: Epigenetic
Novelty: 0.08873031
Score: 0.971
Data Source: Reactome,STRINGDB
EPC1
Tbio
Novelty: 0.0580351
Score: 0.821
Data Source: STRINGDB
EPC2
Tbio
Novelty: 0.0438893
Score: 0.812
Data Source: STRINGDB
KAT6A
Tbio
Family: Epigenetic
Novelty: 0.00869636
Score: 0.783
Data Source: STRINGDB
KAT6B
Tbio
Family: Epigenetic
Novelty: 0.00477661
Score: 0.777
Data Source: STRINGDB
BRPF3
Tchem
Family: Epigenetic
Novelty: 0.22263451
Score: 0.764
Data Source: STRINGDB
Publication Statistics
PubMed Score  82.40

PubMed score by year
PubTator Score  92.58

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQE
1-70
AYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSDYDSSSSKGKKKGRTQKEKKA
70-140
ARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMI
140-210
GCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK
210-249
MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQEAYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSDYDSSSSKGKKKGRTQKEKKAARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK