You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ANGEL1
Protein angel homolog 1

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000251089
  • ENSP00000251089
  • ENSG00000013523

Symbol
  • KIAA0759
  • Ccr4e
  • KIAA0759
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.73
disease perturbation
0.62
histone modification site profile
0.57
cell line
0.55
tissue
0.55


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.03   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 106   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.03   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 106   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (50)
1 – 10 of 50
EIF4E
Tchem
Novelty: 0.00088513
p_int: 0.99995712
p_ni: 0.000041937
p_wrong: 9.43e-7
Score: 0.677
Data Source: BioPlex,STRINGDB
DISC1
Tbio
Novelty: 0.00165188
p_int: 0.999558282
p_ni: 0.000441709
p_wrong: 9e-9
Data Source: BioPlex
ZNF414
Tdark
Novelty: 2
p_int: 0.994361626
p_ni: 0.00563511
p_wrong: 0.000003264
Score: 0.24
Data Source: BioPlex,STRINGDB
APOBEC3D
Tbio
Novelty: 0.02451843
p_int: 0.988935294
p_ni: 0.011054534
p_wrong: 0.000010173
Data Source: BioPlex
IQCN
Tdark
Novelty: 1
p_int: 0.969748459
p_ni: 0.030248562
p_wrong: 0.000002978
Data Source: BioPlex
ZAR1L
Tdark
Novelty: 0.09373976
p_int: 0.964437299
p_ni: 0.021819183
p_wrong: 0.013743518
Data Source: BioPlex
MTHFD1L
Tbio
Family: Enzyme
Novelty: 0.02310578
p_int: 0.956227085
p_ni: 0.043760916
p_wrong: 0.000011999
Data Source: BioPlex
FGFRL1
Tbio
Novelty: 0.02637813
p_int: 0.947009927
p_ni: 0.052949053
p_wrong: 0.00004102
Data Source: BioPlex
SCNN1D
Tbio
Family: IC
Novelty: 0.06253257
p_int: 0.937271409
p_ni: 0.062728591
Score: 0.175
Data Source: BioPlex,STRINGDB
FBXO10
Tbio
Novelty: 0.28307956
p_int: 0.926608513
p_ni: 0.073309849
p_wrong: 0.000081639
Data Source: BioPlex
Publication Statistics
PubMed Score  1.03

PubMed score by year
PubTator Score  1.67

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MIASCLCYLLLPATRLFRALSDAFFTCRKNVLLANSSSPQVEGDFAMAPRGPEQEECEGLLQQWREEGLS
1-70
QVLSTASEGPLIDKGLAQSSLALLMDNPGEENAASEDRWSSRQLSDLRAAENLDEPFPEMLGEEPLLEVE
70-140
GVEGSMWAAIPMQSEPQYADCAALPVGALATEQWEEDPAVLAWSIAPEPVPQEEASIWPFEGLGQLQPPA
140-210
VEIPYHEILWREWEDFSTQPDAQGLKAGDGPQFQFTLMSYNILAQDLMQQSSELYLHCHPDILNWNYRFV
210-280
NLMQEFQHWDPDILCLQEVQEDHYWEQLEPSLRMMGFTCFYKRRTGCKTDGCAVCYKPTRFRLLCASPVE
280-350
YFRPGLELLNRDNVGLVLLLQPLVPEGLGQVSVAPLCVANTHILYNPRRGDVKLAQMAILLAEVDKVARL
350-420
SDGSHCPIILCGDLNSVPDSPLYNFIRDGELQYHGMPAWKVSGQEDFSHQLYQRKLQAPLWPSSLGITDC
420-490
CQYVTSCHPKRSERRKYGRDFLLRFRFCSIACQRPVGLVLMEGVTDTKPERPAGWAESVLEEDASELEPA
490-560
FSRTVGTIQHCLHLTSVYTHFLPQRGRPEVTTMPLGLGMTVDYIFFSAESCENGNRTDHRLYRDGTLKLL
560-630
GRLSLLSEEILWAANGLPNPFCSSDHLCLLASFGMEVTAP
630-670
MIASCLCYLLLPATRLFRALSDAFFTCRKNVLLANSSSPQVEGDFAMAPRGPEQEECEGLLQQWREEGLSQVLSTASEGPLIDKGLAQSSLALLMDNPGEENAASEDRWSSRQLSDLRAAENLDEPFPEMLGEEPLLEVEGVEGSMWAAIPMQSEPQYADCAALPVGALATEQWEEDPAVLAWSIAPEPVPQEEASIWPFEGLGQLQPPAVEIPYHEILWREWEDFSTQPDAQGLKAGDGPQFQFTLMSYNILAQDLMQQSSELYLHCHPDILNWNYRFVNLMQEFQHWDPDILCLQEVQEDHYWEQLEPSLRMMGFTCFYKRRTGCKTDGCAVCYKPTRFRLLCASPVEYFRPGLELLNRDNVGLVLLLQPLVPEGLGQVSVAPLCVANTHILYNPRRGDVKLAQMAILLAEVDKVARLSDGSHCPIILCGDLNSVPDSPLYNFIRDGELQYHGMPAWKVSGQEDFSHQLYQRKLQAPLWPSSLGITDCCQYVTSCHPKRSERRKYGRDFLLRFRFCSIACQRPVGLVLMEGVTDTKPERPAGWAESVLEEDASELEPAFSRTVGTIQHCLHLTSVYTHFLPQRGRPEVTTMPLGLGMTVDYIFFSAESCENGNRTDHRLYRDGTLKLLGRLSLLSEEILWAANGLPNPFCSSDHLCLLASFGMEVTAP