You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
CELA1
Chymotrypsin-like elastase family member 1

Protein Summary
Description
Acts upon elastin. Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, pancreatic elastase 1 is not expressed in the pancreas. To date, elastase 1 expression has only been detected in skin keratinocytes. Clinical literature that describes human elastase 1 activity in the pancreas or fecal material is actually referring to chymotrypsin-like elastase family, member 3B. [provided by RefSeq, May 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000293636
  • ENSP00000293636
  • ENSG00000139610

Symbol
  • ELA1
  • ELA1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
drug
0.77
gene perturbation
0.67
biological process
0.62
disease perturbation
0.62
protein domain
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 275.78   (req: < 5)
Gene RIFs: 12   (req: <= 3)
Antibodies: 146   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 275.78   (req: >= 5)
Gene RIFs: 12   (req: > 3)
Antibodies: 146   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 6
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
telaprevir
chemical structure image
Gene Ontology Terms (17)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (48)
1 – 10 of 48
TUBB1
Tclin
Novelty: 0.05351568
p_int: 0.999928545
p_ni: 0.000071455
Data Source: BioPlex
SMYD2
Tchem
Family: Epigenetic
Novelty: 0.01010557
p_int: 0.99642101
p_ni: 0.003468042
p_wrong: 0.000110948
Score: 0.187
Data Source: BioPlex,STRINGDB
PRR14
Tbio
Novelty: 0.16853933
p_int: 0.994863935
p_ni: 0.000164831
p_wrong: 0.004971235
Data Source: BioPlex
SIPA1L2
Tdark
Novelty: 0.35264082
p_int: 0.994659166
p_ni: 0.005287385
p_wrong: 0.000053449
Score: 0.173
Data Source: BioPlex,STRINGDB
GLI3
Tbio
Family: TF
Novelty: 0.00059889
p_int: 0.990796747
p_ni: 0.007986881
p_wrong: 0.001216372
Score: 0.235
Data Source: BioPlex,STRINGDB
ZNF318
Tbio
Novelty: 0.04010695
p_int: 0.98596218
p_ni: 0.014037815
p_wrong: 5e-9
Data Source: BioPlex
KRBA1
Tdark
Novelty: 3.75
p_int: 0.962979507
p_ni: 0.037018164
p_wrong: 0.00000233
Data Source: BioPlex
BCOR
Tbio
Novelty: 0.00898286
p_int: 0.959490495
p_ni: 0.040509505
Data Source: BioPlex
HDAC3
Tclin
Family: Epigenetic
Novelty: 0.00453537
p_int: 0.944434767
p_ni: 0.055550934
p_wrong: 0.000014299
Score: 0.169
Data Source: BioPlex,STRINGDB
CEP164
Tbio
Novelty: 0.07209475
p_int: 0.941351412
p_ni: 0.05832997
p_wrong: 0.000318618
Score: 0.181
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  275.78

PubMed score by year
PubTator Score  251.85

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGTLIRQNWVMTAAHCVDYQKT
1-70
FRVVAGDHNLSQNDGTEQYVSVQKIVVHPYWNSDNVAAGYDIALLRLAQSVTLNSYVQLGVLPQEGAILA
70-140
NNSPCYITGWGKTKTNGQLAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPL
140-210
HCLVNGKYSVHGVTSFVSSRGCNVSRKPTVFTQVSAYISWINNVIASN
210-258
MLVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGTLIRQNWVMTAAHCVDYQKTFRVVAGDHNLSQNDGTEQYVSVQKIVVHPYWNSDNVAAGYDIALLRLAQSVTLNSYVQLGVLPQEGAILANNSPCYITGWGKTKTNGQLAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRKPTVFTQVSAYISWINNVIASN