You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SOX13
Transcription factor SOX-13

Protein Summary
Description
Binds to the sequence 5'-AACAAT-3'. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. It has also been determined to be a type-1 diabetes autoantigen, also known as islet cell antibody 12. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000367204
  • ENSP00000356172
  • ENSG00000143842
  • ENST00000618875
  • ENSP00000478239

Symbol
  • ICA12
  • Sox-13
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.9
PubMedID
0.76
virus perturbation
0.76
transcription factor binding site profile
0.72
cell type or tissue
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 32.01   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 169   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 32.01   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 169   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
Deactivation of the beta-catenin transactivating complex (R-HSA-3769402)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Deactivation of the beta-catenin transactivating complex
Reactome
Signal Transduction
Reactome
Signaling by WNT
Reactome
TCF dependent signaling in response to WNT
Name
Explore in Pharos
Explore in Source
Deactivation of the beta-catenin transactivating complex
Signal Transduction
Signaling by WNT
TCF dependent signaling in response to WNT
Gene Ontology Terms (11)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence Alignment (ISA)
NTNU_SB
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (28)
1 – 10 of 28
SOX5
Tbio
Family: TF
Novelty: 0.00803388
p_int: 0.999999998
p_wrong: 2e-9
Score: 0.858
Data Source: BioPlex,STRINGDB
CEP85
Tdark
Novelty: 0.46332046
p_int: 0.999958353
p_ni: 0.000009138
p_wrong: 0.000032509
Score: 0.847
Data Source: BioPlex,STRINGDB
CLEC12A
Tbio
Novelty: 0.02175617
p_int: 0.999798263
p_ni: 0.000201723
p_wrong: 1.3e-8
Score: 0.205
Data Source: BioPlex,STRINGDB
NUP62
Tbio
Novelty: 0.01433478
p_int: 0.996867133
p_ni: 0.003132824
p_wrong: 4.3e-8
Data Source: BioPlex
LEF1
Tchem
Family: TF
Novelty: 0.00223818
Score: 0.924
Data Source: Reactome,STRINGDB
TCF7
Tbio
Family: TF
Novelty: 0.0150836
Score: 0.924
Data Source: STRINGDB
CTNNB1
Tchem
Novelty: 0.00008951
Score: 0.921
Data Source: Reactome,STRINGDB
TCF7L2
Tbio
Family: TF
Novelty: 0.00205974
Score: 0.916
Data Source: Reactome,STRINGDB
TCF7L1
Tbio
Family: TF
Novelty: 0.0511399
Score: 0.916
Data Source: STRINGDB
PTPRN
Tbio
Family: Enzyme
Novelty: 0.00120688
Score: 0.57
Data Source: STRINGDB
Publication Statistics
PubMed Score  32.01

PubMed score by year
PubTator Score  19.24

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSMRSPISAQLALDGVGTMVNCTIKSEEKKEPCHEAPQGSATAAEPQPGDPARASQDSADPQAPAQGNFR
1-70
GSWDCSSPEGNGSPEPKRPGVSEAASGSQEKLDFNRNLKEVVPAIEKLLSSDWKERFLGRNSMEAKDVKG
70-140
TQESLAEKELQLLVMIHQLSTLRDQLLTAHSEQKNMAAMLFEKQQQQMELARQQQEQIAKQQQQLIQQQH
140-210
KINLLQQQIQQVNMPYVMIPAFPPSHQPLPVTPDSQLALPIQPIPCKPVEYPLQLLHSPPAPVVKRPGAM
210-280
ATHHPLQEPSQPLNLTAKPKAPELPNTSSSPSLKMSSCVPRPPSHGGPTRDLQSSPPSLPLGFLGEGDAV
280-350
TKAIQDARQLLHSHSGALDGSPNTPFRKDLISLDSSPAKERLEDGCVHPLEEAMLSCDMDGSRHFPESRN
350-420
SSHIKRPMNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPD
420-490
YKYKPRPKRTCIVEGKRLRVGEYKALMRTRRQDARQSYVIPPQAGQVQMSSSDVLYPRAAGMPLAQPLVE
490-560
HYVPRSLDPNMPVIVNTCSLREEGEGTDDRHSVADGEMYRYSEDEDSEGEEKSDGELVVLTD
560-622
MSMRSPISAQLALDGVGTMVNCTIKSEEKKEPCHEAPQGSATAAEPQPGDPARASQDSADPQAPAQGNFRGSWDCSSPEGNGSPEPKRPGVSEAASGSQEKLDFNRNLKEVVPAIEKLLSSDWKERFLGRNSMEAKDVKGTQESLAEKELQLLVMIHQLSTLRDQLLTAHSEQKNMAAMLFEKQQQQMELARQQQEQIAKQQQQLIQQQHKINLLQQQIQQVNMPYVMIPAFPPSHQPLPVTPDSQLALPIQPIPCKPVEYPLQLLHSPPAPVVKRPGAMATHHPLQEPSQPLNLTAKPKAPELPNTSSSPSLKMSSCVPRPPSHGGPTRDLQSSPPSLPLGFLGEGDAVTKAIQDARQLLHSHSGALDGSPNTPFRKDLISLDSSPAKERLEDGCVHPLEEAMLSCDMDGSRHFPESRNSSHIKRPMNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPKRTCIVEGKRLRVGEYKALMRTRRQDARQSYVIPPQAGQVQMSSSDVLYPRAAGMPLAQPLVEHYVPRSLDPNMPVIVNTCSLREEGEGTDDRHSVADGEMYRYSEDEDSEGEEKSDGELVVLTD