Protein Summary
Reversible hydration of carbon dioxide. Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA XIV is predicted to be a type I membrane protein and shares highest sequence similarity with the other transmembrane CA isoform, CA XII; however, they have different patterns of tissue-specific expression and thus may play different physiologic roles. [provided by RefSeq, Jul 2008]
- ENST00000369111
- ENSP00000358107
- ENSG00000118298
- ENST00000647854
- ENSP00000498013
- CAXiV
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
cell type or tissue | 0.89 | ||
gene perturbation | 0.82 | ||
disease perturbation | 0.68 | ||
histone modification site profile | 0.63 | ||
transcription factor | 0.55 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 141.74 (req: < 5)
Gene RIFs: 4 (req: <= 3)
Antibodies: 177 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 141.74 (req: >= 5)
Gene RIFs: 4 (req: > 3)
Antibodies: 177 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 3
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligands: 402
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drugs: 14
Approved Drugs (14)
1 – 10 of 14
Active Ligands (402)
1 – 10 of 402
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id | Ligand | Method | Resolution (Ã…) | M.W. (kDa) | Pub Year | Title |
---|
PDB Structure Id | M.W. | Resolution | Pub Year |
---|
Pathways (4)
Reactome (2)
KEGG (2)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 2 of 2
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Metabolism | ||||
Reactome | Reversible hydration of carbon dioxide | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Metabolism | ||||
Reversible hydration of carbon dioxide | ||||
Gene Ontology Terms (5)
Functions (2)
Components (2)
Processes (1)
Items per page:
10
1 – 2 of 2
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Traceable Author Statement (TAS) | Reactome | |||
Inferred from Electronic Annotation (IEA) | InterPro | |||
Protein-Protein Interactions (77)
1 – 10 of 77
CIP2A
Novelty: 0.00948462
p_int: 0.999964779
p_ni: 0.000035221
Data Source: BioPlex
SLC38A7
Family: Transporter
Novelty: 0.30036308
p_int: 0.999944619
p_ni: 0.000048157
p_wrong: 0.000007224
Data Source: BioPlex
ATR
Family: Kinase
Novelty: 0.00246592
p_int: 0.999908108
p_ni: 0.000091892
Data Source: BioPlex
NF1
Novelty: 0.00021961
p_int: 0.999361013
p_ni: 0.000638985
p_wrong: 2e-9
Data Source: BioPlex
DNM1L
Novelty: 0.00184129
p_int: 0.996576656
p_ni: 0.003226159
p_wrong: 0.000197185
Data Source: BioPlex
PEX19
Novelty: 0.00469515
p_int: 0.995348645
p_ni: 0.004651355
Data Source: BioPlex
EIF2B4
Novelty: 0.07295839
p_int: 0.992883128
p_ni: 0.007116872
Data Source: BioPlex
EIF2B5
Novelty: 0.01114599
p_int: 0.991481416
p_ni: 0.008518519
p_wrong: 6.5e-8
Score: 0.219
Data Source: BioPlex,STRINGDB
XPO6
Novelty: 0.0244998
p_int: 0.989910005
p_ni: 0.010089995
Data Source: BioPlex
EIF2B3
Novelty: 0.05806987
p_int: 0.98989503
p_ni: 0.01010497
Data Source: BioPlex
Publication Statistics
PubMed Score 141.74
PubMed score by year
PubTator Score 48.59
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYD
1-70
QPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYD
70-140
SDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYF
140-210
RYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQ
210-280
AGSSYTTGEMLSLGVGILVGCLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
280-337
MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVGCLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
Find similar targets by: