You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
CA14
Carbonic anhydrase 14

Protein Summary
Description
Reversible hydration of carbon dioxide. Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA XIV is predicted to be a type I membrane protein and shares highest sequence similarity with the other transmembrane CA isoform, CA XII; however, they have different patterns of tissue-specific expression and thus may play different physiologic roles. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000369111
  • ENSP00000358107
  • ENSG00000118298
  • ENST00000647854
  • ENSP00000498013

Symbol
  • CAXiV
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.89
gene perturbation
0.82
disease perturbation
0.68
histone modification site profile
0.63
transcription factor
0.55


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 141.74   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 177   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 141.74   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 177   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 402
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 14
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (4)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 2 of 2
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Reversible hydration of carbon dioxide
Name
Explore in Pharos
Explore in Source
Metabolism
Reversible hydration of carbon dioxide
Gene Ontology Terms (5)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (77)
1 – 10 of 77
CIP2A
Tbio
Novelty: 0.00948462
p_int: 0.999964779
p_ni: 0.000035221
Data Source: BioPlex
SLC38A7
Tdark
Family: Transporter
Novelty: 0.30036308
p_int: 0.999944619
p_ni: 0.000048157
p_wrong: 0.000007224
Data Source: BioPlex
ATR
Tchem
Family: Kinase
Novelty: 0.00246592
p_int: 0.999908108
p_ni: 0.000091892
Data Source: BioPlex
NF1
Tbio
Novelty: 0.00021961
p_int: 0.999361013
p_ni: 0.000638985
p_wrong: 2e-9
Data Source: BioPlex
DNM1L
Tbio
Novelty: 0.00184129
p_int: 0.996576656
p_ni: 0.003226159
p_wrong: 0.000197185
Data Source: BioPlex
PEX19
Tbio
Novelty: 0.00469515
p_int: 0.995348645
p_ni: 0.004651355
Data Source: BioPlex
EIF2B4
Tbio
Novelty: 0.07295839
p_int: 0.992883128
p_ni: 0.007116872
Data Source: BioPlex
EIF2B5
Tbio
Novelty: 0.01114599
p_int: 0.991481416
p_ni: 0.008518519
p_wrong: 6.5e-8
Score: 0.219
Data Source: BioPlex,STRINGDB
XPO6
Tbio
Novelty: 0.0244998
p_int: 0.989910005
p_ni: 0.010089995
Data Source: BioPlex
EIF2B3
Tbio
Novelty: 0.05806987
p_int: 0.98989503
p_ni: 0.01010497
Data Source: BioPlex
Publication Statistics
PubMed Score  141.74

PubMed score by year
PubTator Score  48.59

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYD
1-70
QPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYD
70-140
SDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYF
140-210
RYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQ
210-280
AGSSYTTGEMLSLGVGILVGCLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
280-337
MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVGCLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA