You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
EMCN
Endomucin

Protein Summary
Description
Endothelial sialomucin, also called endomucin or mucin-like sialoglycoprotein, which interferes with the assembly of focal adhesion complexes and inhibits interaction between cells and the extracellular matrix. EMCN is a mucin-like sialoglycoprotein that interferes with the assembly of focal adhesion complexes and inhibits interaction between cells and the extracellular matrix (Kinoshita et al., 2001 [PubMed 11418125]).[supplied by OMIM, Mar 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000296420
  • ENSP00000296420
  • ENSG00000164035
  • ENST00000305864
  • ENSP00000304780
  • ENST00000511970
  • ENSP00000422432

Symbol
  • EMCN2
  • MUC14
  • EMCN2
  • MUC14
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.85
tissue sample
0.69
PubMedID
0.63
cell type or tissue
0.58
disease perturbation
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 24.16   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 188   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 24.16   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 188   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (3)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Protein-Protein Interactions (41)
1 – 10 of 41
OSGEP
Tbio
Family: Enzyme
Novelty: 0.01348632
Score: 0.937
Data Source: STRINGDB
SELL
Tchem
Novelty: 0.00035489
Score: 0.712
Data Source: STRINGDB
NTAN1
Tbio
Family: Enzyme
Novelty: 0.00549432
Score: 0.696
Data Source: STRINGDB
PECAM1
Tbio
Novelty: 0.00020273
Score: 0.696
Data Source: STRINGDB
ADGRL4
Tbio
Family: GPCR
Novelty: 0.00456769
Score: 0.688
Data Source: STRINGDB
MYCT1
Tbio
Novelty: 0.07073512
Score: 0.625
Data Source: STRINGDB
CDH5
Tbio
Novelty: 0.00096405
Score: 0.606
Data Source: STRINGDB
OCIAD2
Tbio
Novelty: 0.23622047
Score: 0.592
Data Source: STRINGDB
SYNPO2
Tbio
Novelty: 0.03724055
Score: 0.579
Data Source: STRINGDB
CD300LG
Tbio
Novelty: 0.12059672
Score: 0.576
Data Source: STRINGDB
Publication Statistics
PubMed Score  24.16

PubMed score by year
PubTator Score  11.34

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MELLQVTILFLLPSICSSNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELL
1-70
KMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGS
70-140
VLQPDASPSKTGTLTSIPVTIPENTSQSQVIGTEGGKNASTSATSRSYSSIILPVVIALIVITLSVFVLV
140-210
GLYRMCWKADPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKTKN
210-261
MELLQVTILFLLPSICSSNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGSVLQPDASPSKTGTLTSIPVTIPENTSQSQVIGTEGGKNASTSATSRSYSSIILPVVIALIVITLSVFVLVGLYRMCWKADPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKTKN