You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ACAD8
Isobutyryl-CoA dehydrogenase, mitochondrial

Protein Summary
Description
Has very high activity toward isobutyryl-CoA. Is an isobutyryl-CoA dehydrogenase that functions in valine catabolism. Plays a role in transcriptional coactivation within the ARC complex. This gene encodes a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. The encoded protein is a mitochondrial enzyme that functions in catabolism of the branched-chain amino acid valine. Defects in this gene are the cause of isobutyryl-CoA dehydrogenase deficiency.[provided by RefSeq, Nov 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000281182
  • ENSP00000281182
  • ENSG00000151498
  • ENST00000374752
  • ENSP00000363884

Symbol
  • ARC42
  • IBD
  • ARC42
  • ACAD-8
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.88
virus perturbation
0.88
disease perturbation
0.83
protein domain
0.73
tissue sample
0.72


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 11.51   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 179   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 11.51   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 179   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (6)
Branched-chain amino acid catabolism (R-HSA-70895)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Branched-chain amino acid catabolism
Reactome
Metabolism
Reactome
Metabolism of amino acids and derivatives
Name
Explore in Pharos
Explore in Source
Branched-chain amino acid catabolism
Metabolism
Metabolism of amino acids and derivatives
Protein-Protein Interactions (58)
1 – 10 of 58
VPS37D
Tdark
Novelty: 3.21428571
p_int: 0.999893956
p_ni: 0.000106044
Score: 0.26
Data Source: BioPlex,STRINGDB
VSTM2A
Tbio
Novelty: 0.69230769
p_int: 0.996051445
p_ni: 0.003948555
Score: 0.517
Data Source: BioPlex,STRINGDB
SRGAP3
Tbio
Family: Enzyme
Novelty: 0.01572334
p_int: 0.899120832
p_ni: 0.100879168
Score: 0.243
Data Source: BioPlex,STRINGDB
DUSP14
Tbio
Family: Enzyme
Novelty: 0.06597118
p_int: 0.866787099
p_ni: 0.133212901
Data Source: BioPlex
FAM161B
Tdark
Novelty: 0.78431373
p_int: 0.849226158
p_ni: 0.150773842
Score: 0.403
Data Source: BioPlex,STRINGDB
FCGR1A
Tchem
Novelty: 0.00091043
p_int: 0.819087734
p_ni: 0.180912266
Score: 0.189
Data Source: BioPlex,STRINGDB
POLM
Tbio
Family: Enzyme
Novelty: 0.00377692
p_int: 0.807032676
p_ni: 0.192967323
Score: 0.403
Data Source: BioPlex,STRINGDB
ECHS1
Tbio
Family: Enzyme
Novelty: 0.01956365
Score: 0.936
Data Source: STRINGDB
BCKDHB
Tbio
Family: Enzyme
Novelty: 0.03
Score: 0.935
Data Source: STRINGDB
HADHA
Tbio
Novelty: 0.00234785
Score: 0.931
Data Source: STRINGDB
Publication Statistics
PubMed Score  11.51

PubMed score by year
PubTator Score  9.58

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLWSGCRRFGARLGCLPGGLRVLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQK
1-70
ELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEE
70-140
QRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVVMCRTGGP
140-210
GPKGISCIVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINI
210-280
ASCSLGAAHASVILTRDHLNVRKQFGEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVAL
280-350
CSMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE
350-415
MLWSGCRRFGARLGCLPGGLRVLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVVMCRTGGPGPKGISCIVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINIASCSLGAAHASVILTRDHLNVRKQFGEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE