You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ACSL6
Long-chain-fatty-acid--CoA ligase 6

Protein Classes
Protein Summary
Description
Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Plays an important role in fatty acid metabolism in brain and the acyl-CoAs produced may be utilized exclusively for the synthesis of the brain lipid. The protein encoded by this gene catalyzes the formation of acyl-CoA from fatty acids, ATP, and CoA, using magnesium as a cofactor. The encoded protein plays a major role in fatty acid metabolism in the brain. Translocations with the ETV6 gene are causes of myelodysplastic syndrome with basophilia, acute myelogenous leukemia with eosinophilia, and acute eosinophilic leukemia. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Apr 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000296869
  • ENSP00000296869
  • ENSG00000164398
  • ENST00000357096
  • ENSP00000349608
  • ENST00000379240
  • ENSP00000368542
  • ENST00000379244
  • ENSP00000368546
  • ENST00000379246
  • ENSP00000368548
  • ENST00000379255
  • ENSP00000368557
  • ENST00000379264
  • ENSP00000368566
  • ENST00000543479
  • ENSP00000442124

Symbol
  • ACS2
  • FACL6
  • KIAA0837
  • LACS5
  • ACS2
  • FACL6
  • LACS2
  • LACS5
  • LACS 6
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.96
molecular function
0.93
cellular component
0.79
disease perturbation
0.74
transcription factor perturbation
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 83.37   (req: < 5)
Gene RIFs: 15   (req: <= 3)
Antibodies: 176   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 83.37   (req: >= 5)
Gene RIFs: 15   (req: > 3)
Antibodies: 176   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (22)
Fatty acid metabolism (R-HSA-8978868)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Fatty acid metabolism
Reactome
Fatty acyl-CoA biosynthesis
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Synthesis of very long-chain fatty acyl-CoAs
Name
Explore in Pharos
Explore in Source
Fatty acid metabolism
Fatty acyl-CoA biosynthesis
Metabolism
Metabolism of lipids
Synthesis of very long-chain fatty acyl-CoAs
Protein-Protein Interactions (109)
1 – 10 of 109
ACOX1
Tbio
Family: Enzyme
Novelty: 0.00626693
Score: 0.952
Data Source: STRINGDB
ACOX2
Tbio
Family: Enzyme
Novelty: 0.05104162
Score: 0.949
Data Source: STRINGDB
ACADL
Tbio
Family: Enzyme
Novelty: 0.05595766
Score: 0.938
Data Source: STRINGDB
FASN
Tchem
Family: Enzyme
Novelty: 0.00201045
Score: 0.93
Data Source: STRINGDB
FADS2
Tbio
Family: Enzyme
Novelty: 0.00246531
Score: 0.922
Data Source: STRINGDB
MGLL
Tchem
Family: Enzyme
Novelty: 0.00291863
Score: 0.834
Data Source: STRINGDB
PHYH
Tbio
Family: Enzyme
Novelty: 0.00437903
Score: 0.815
Data Source: STRINGDB
LPL
Tchem
Family: Enzyme
Novelty: 0.00074704
Score: 0.804
Data Source: STRINGDB
HSD17B4
Tbio
Novelty: 0.00700004
Score: 0.78
Data Source: STRINGDB
ACSL4
Tbio
Family: Enzyme
Novelty: 0.01090254
Score: 0.773
Data Source: STRINGDB
Publication Statistics
PubMed Score  83.37

PubMed score by year
PubTator Score  13.41

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQTQEILRILRLPELGDLGQFFRSLSATTLVSMGALAAILAYWFTHRPKALQPPCNLLMQSEEVEDSGGA
1-70
RRSVIGSGPQLLTHYYDDARTMYQVFRRGLSISGNGPCLGFRKPKQPYQWLSYQEVADRAEFLGSGLLQH
70-140
NCKACTDQFIGVFAQNRPEWIIVELACYTYSMVVVPLYDTLGPGAIRYIINTADISTVIVDKPQKAVLLL
140-210
EHVERKETPGLKLIILMDPFEEALKERGQKCGVVIKSMQAVEDCGQENHQAPVPPQPDDLSIVCFTSGTT
210-280
GNPKGAMLTHGNVVADFSGFLKVTEKVIFPRQDDVLISFLPLAHMFERVIQSVVYCHGGRVGFFQGDIRL
280-350
LSDDMKALCPTIFPVVPRLLNRMYDKIFSQANTPLKRWLLEFAAKRKQAEVRSGIIRNDSIWDELFFNKI
350-420
QASLGGCVRMIVTGAAPASPTVLGFLRAALGCQVYEGYGQTECTAGCTFTTPGDWTSGHVGAPLPCNHIK
420-490
LVDVEELNYWACKGEGEICVRGPNVFKGYLKDPDRTKEALDSDGWLHTGDIGKWLPAGTLKIIDRKKHIF
490-560
KLAQGEYVAPEKIENIYIRSQPVAQIYVHGDSLKAFLVGIVVPDPEVMPSWAQKRGIEGTYADLCTNKDL
560-630
KKAILEDMVRLGKESGLHSFEQVKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELYSISM
630-697
MQTQEILRILRLPELGDLGQFFRSLSATTLVSMGALAAILAYWFTHRPKALQPPCNLLMQSEEVEDSGGARRSVIGSGPQLLTHYYDDARTMYQVFRRGLSISGNGPCLGFRKPKQPYQWLSYQEVADRAEFLGSGLLQHNCKACTDQFIGVFAQNRPEWIIVELACYTYSMVVVPLYDTLGPGAIRYIINTADISTVIVDKPQKAVLLLEHVERKETPGLKLIILMDPFEEALKERGQKCGVVIKSMQAVEDCGQENHQAPVPPQPDDLSIVCFTSGTTGNPKGAMLTHGNVVADFSGFLKVTEKVIFPRQDDVLISFLPLAHMFERVIQSVVYCHGGRVGFFQGDIRLLSDDMKALCPTIFPVVPRLLNRMYDKIFSQANTPLKRWLLEFAAKRKQAEVRSGIIRNDSIWDELFFNKIQASLGGCVRMIVTGAAPASPTVLGFLRAALGCQVYEGYGQTECTAGCTFTTPGDWTSGHVGAPLPCNHIKLVDVEELNYWACKGEGEICVRGPNVFKGYLKDPDRTKEALDSDGWLHTGDIGKWLPAGTLKIIDRKKHIFKLAQGEYVAPEKIENIYIRSQPVAQIYVHGDSLKAFLVGIVVPDPEVMPSWAQKRGIEGTYADLCTNKDLKKAILEDMVRLGKESGLHSFEQVKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELYSISM