You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
UTS2R
Urotensin-2 receptor

Protein Summary
Description
High affinity receptor for urotensin-2 and urotensin-2B. The activity of this receptor is mediated by a G-protein that activate a phosphatidylinositol-calcium second messenger system.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000313135
  • ENSP00000323516
  • ENSG00000181408

Symbol
  • GPR14
  • UTR
  • UTR2
  • GPR14
  • UR-2-R
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.72
gene perturbation
0.7
ligand (chemical)
0.61
biological term
0.52
cell line
0.5


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 67.15   (req: < 5)
Gene RIFs: 31   (req: <= 3)
Antibodies: 225   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 67.15   (req: >= 5)
Gene RIFs: 31   (req: > 3)
Antibodies: 225   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 146
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (25)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (q) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Peptide ligand-binding receptors
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
G alpha (q) signalling events
GPCR downstream signalling
GPCR ligand binding
Peptide ligand-binding receptors
Protein-Protein Interactions (198)
1 – 10 of 198
UTS2
Tbio
Novelty: 0.0029971
Score: 0.994
Data Source: Reactome,STRINGDB
UTS2B
Tbio
Novelty: 0.04729463
Score: 0.987
Data Source: Reactome,STRINGDB
KISS1R
Tchem
Family: GPCR
Novelty: 0.00324819
Score: 0.957
Data Source: STRINGDB
EDN1
Tbio
Novelty: 0.000085
Score: 0.95
Data Source: STRINGDB
GPR153
Tdark
Family: GPCR
Novelty: 0.62164662
Score: 0.937
Data Source: STRINGDB
NTS
Tbio
Novelty: 0.00035891
Score: 0.935
Data Source: STRINGDB
PTGER1
Tclin
Family: GPCR
Novelty: 0.00206493
Score: 0.934
Data Source: STRINGDB
GNG3
Tbio
Novelty: 0.16248863
Score: 0.93
Data Source: STRINGDB
AVP
Tbio
Novelty: 0.0001163
Score: 0.925
Data Source: STRINGDB
NPFF
Tbio
Novelty: 0.00350925
Score: 0.922
Data Source: STRINGDB
Publication Statistics
PubMed Score  67.15

PubMed score by year
PubTator Score  116.11

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MALTPESPSSFPGLAATGSSVPEPPGGPNATLNSSWASPTEPSSLEDLVATGTIGTLLSAMGVVGVVGNA
1-70
YTLVVTCRSLRAVASMYVYVVNLALADLLYLLSIPFIVATYVTKEWHFGDVGCRVLFGLDFLTMHASIFT
70-140
LTVMSSERYAAVLRPLDTVQRPKGYRKLLALGTWLLALLLTLPVMLAMRLVRRGPKSLCLPAWGPRAHRA
140-210
YLTLLFATSIAGPGLLIGLLYARLARAYRRSQRASFKRARRPGARALRLVLGIVLLFWACFLPFWLWQLL
210-280
AQYHQAPLAPRTARIVNYLTTCLTYGNSCANPFLYTLLTRNYRDHLRGRVRGPGSGGGRGPVPSLQPRAR
280-350
FQRCSGRSLSSCSPQPTDSLVLAPAAPARPAPEGPRAPA
350-389
MALTPESPSSFPGLAATGSSVPEPPGGPNATLNSSWASPTEPSSLEDLVATGTIGTLLSAMGVVGVVGNAYTLVVTCRSLRAVASMYVYVVNLALADLLYLLSIPFIVATYVTKEWHFGDVGCRVLFGLDFLTMHASIFTLTVMSSERYAAVLRPLDTVQRPKGYRKLLALGTWLLALLLTLPVMLAMRLVRRGPKSLCLPAWGPRAHRAYLTLLFATSIAGPGLLIGLLYARLARAYRRSQRASFKRARRPGARALRLVLGIVLLFWACFLPFWLWQLLAQYHQAPLAPRTARIVNYLTTCLTYGNSCANPFLYTLLTRNYRDHLRGRVRGPGSGGGRGPVPSLQPRARFQRCSGRSLSSCSPQPTDSLVLAPAAPARPAPEGPRAPA