You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
MAN1B1
Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase

Protein Classes
Protein Summary
Description
Involved in glycoprotein quality control targeting of misfolded glycoproteins for degradation. It primarily trims a single alpha-1,2-linked mannose residue from Man(9)GlcNAc(2) to produce Man(8)GlcNAc(2), but at high enzyme concentrations, as found in the ER quality control compartment (ERQC), it further trims the carbohydrates to Man(5-6)GlcNAc(2). This gene encodes an enzyme belonging to the glycosyl hydrolase 47 family. This enzyme functions in N-glycan biosynthesis, and is a class I alpha-1,2-mannosidase that specifically converts Man9GlcNAc to Man8GlcNAc isomer B. It is required for N-glycan trimming to Man5-6GlcNAc2 in the endoplasmic-reticulum-associated degradation pathway. Mutations in this gene cause autosomal-recessive intellectual disability. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 11. [provided by RefSeq, Dec 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000371589
  • ENSP00000360645
  • ENSG00000177239

Symbol
  • MRT15
  • ERMAN1
  • ERManI
  • MANA-ER
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.83
transcription factor binding site profile
0.83
histone modification site profile
0.75
tissue sample
0.67
transcription factor
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 57.91   (req: < 5)
Gene RIFs: 24   (req: <= 3)
Antibodies: 130   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 57.91   (req: >= 5)
Gene RIFs: 24   (req: > 3)
Antibodies: 130   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 8
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (15)
Asparagine N-linked glycosylation (R-HSA-446203)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Asparagine N-linked glycosylation
Reactome
Calnexin/calreticulin cycle
Reactome
Defective MAN1B1 causes MRT15
Reactome
Disease
Reactome
Diseases associated with N-glycosylation of proteins
Name
Explore in Pharos
Explore in Source
Asparagine N-linked glycosylation
Calnexin/calreticulin cycle
Defective MAN1B1 causes MRT15
Disease
Diseases associated with N-glycosylation of proteins
Protein-Protein Interactions (66)
1 – 10 of 66
RANBP6
Tdark
Novelty: 2.35714286
p_int: 0.905197585
p_ni: 0.094802415
Score: 0.163
Data Source: BioPlex,STRINGDB
CCNDBP1
Tbio
Novelty: 0.02585442
p_int: 0.796004372
p_ni: 0.203995628
Score: 0.252
Data Source: BioPlex,STRINGDB
CD79B
Tclin
Novelty: 0.00265318
p_int: 0.788552909
p_ni: 0.211447091
Data Source: BioPlex
MGAT1
Tchem
Family: Enzyme
Novelty: 0.01240487
Score: 0.953
Data Source: STRINGDB
GANAB
Tchem
Family: Enzyme
Novelty: 0.01709359
Score: 0.946
Data Source: STRINGDB
MANEA
Tbio
Family: Enzyme
Novelty: 0.03417339
Score: 0.927
Data Source: STRINGDB
MOGS
Tbio
Family: Enzyme
Novelty: 0.00521537
Score: 0.83
Data Source: STRINGDB
MAN2A1
Tbio
Family: Enzyme
Novelty: 0.06561713
Score: 0.813
Data Source: STRINGDB
OS9
Tbio
Novelty: 0.01598375
Score: 0.805
Data Source: STRINGDB
RER1
Tbio
Novelty: 0.02445887
Score: 0.78
Data Source: STRINGDB
Publication Statistics
PubMed Score  57.91

PubMed score by year
PubTator Score  21.53

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAACEGRRSGALGSSQSDFLTPPVGGAPWAVATTVVMYPPPPPPPHRDFISVTLSFGENYDNSKSWRRRS
1-70
CWRKWKQLSRLQRNMILFLLAFLLFCGLLFYINLADHWKALAFRLEEEQKMRPEIAGLKPANPPVLPAPQ
70-140
KADTDPENLPEISSQKTQRHIQRGPPHLQIRPPSQDLKDGTQEEATKRQEAPVDPRPEGDPQRTVISWRG
140-210
AVIEPEQGTELPSRRAEVPTKPPLPPARTQGTPVHLNYRQKGVIDVFLHAWKGYRKFAWGHDELKPVSRS
210-280
FSEWFGLGLTLIDALDTMWILGLRKEFEEARKWVSKKLHFEKDVDVNLFESTIRILGGLLSAYHLSGDSL
280-350
FLRKAEDFGNRLMPAFRTPSKIPYSDVNIGTGVAHPPRWTSDSTVAEVTSIQLEFRELSRLTGDKKFQEA
350-420
VEKVTQHIHGLSGKKDGLVPMFINTHSGLFTHLGVFTLGARADSYYEYLLKQWIQGGKQETQLLEDYVEA
420-490
IEGVRTHLLRHSEPSKLTFVGELAHGRFSAKMDHLVCFLPGTLALGVYHGLPASHMELAQELMETCYQMN
490-560
RQMETGLSPEIVHFNLYPQPGRRDVEVKPADRHNLLRPETVESLFYLYRVTGDRKYQDWGWEILQSFSRF
560-630
TRVPSGGYSSINNVQDPQKPEPRDKMESFFLGETLKYLFLLFSDDPNLLSLDAYVFNTEAHPLPIWTPA
630-699
MAACEGRRSGALGSSQSDFLTPPVGGAPWAVATTVVMYPPPPPPPHRDFISVTLSFGENYDNSKSWRRRSCWRKWKQLSRLQRNMILFLLAFLLFCGLLFYINLADHWKALAFRLEEEQKMRPEIAGLKPANPPVLPAPQKADTDPENLPEISSQKTQRHIQRGPPHLQIRPPSQDLKDGTQEEATKRQEAPVDPRPEGDPQRTVISWRGAVIEPEQGTELPSRRAEVPTKPPLPPARTQGTPVHLNYRQKGVIDVFLHAWKGYRKFAWGHDELKPVSRSFSEWFGLGLTLIDALDTMWILGLRKEFEEARKWVSKKLHFEKDVDVNLFESTIRILGGLLSAYHLSGDSLFLRKAEDFGNRLMPAFRTPSKIPYSDVNIGTGVAHPPRWTSDSTVAEVTSIQLEFRELSRLTGDKKFQEAVEKVTQHIHGLSGKKDGLVPMFINTHSGLFTHLGVFTLGARADSYYEYLLKQWIQGGKQETQLLEDYVEAIEGVRTHLLRHSEPSKLTFVGELAHGRFSAKMDHLVCFLPGTLALGVYHGLPASHMELAQELMETCYQMNRQMETGLSPEIVHFNLYPQPGRRDVEVKPADRHNLLRPETVESLFYLYRVTGDRKYQDWGWEILQSFSRFTRVPSGGYSSINNVQDPQKPEPRDKMESFFLGETLKYLFLLFSDDPNLLSLDAYVFNTEAHPLPIWTPA