You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
TNIK
TRAF2 and NCK-interacting protein kinase

Protein Summary
Description
Serine/threonine kinase that acts as an essential activator of the Wnt signaling pathway. Recruited to promoters of Wnt target genes and required to activate their expression. May act by phosphorylating TCF4/TCF7L2. Appears to act upstream of the JUN N-terminal pathway. May play a role in the response to environmental stress. Part of a signaling complex composed of NEDD4, RAP2A and TNIK which regulates neuronal dendrite extension and arborization during development. More generally, it may play a role in cytoskeletal rearrangements and regulate cell spreading. Phosphorylates SMAD1 on Thr-322. Wnt signaling plays important roles in carcinogenesis and embryonic development. The protein encoded by this gene is a serine/threonine kinase that functions as an activator of the Wnt signaling pathway. Mutations in this gene are associated with an autosomal recessive form of cognitive disability. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided b ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000284483
  • ENSP00000284483
  • ENSG00000154310
  • ENST00000341852
  • ENSP00000345352
  • ENST00000357327
  • ENSP00000349880
  • ENST00000436636
  • ENSP00000399511
  • ENST00000460047
  • ENSP00000418916
  • ENST00000470834
  • ENSP00000419990
  • ENST00000475336
  • ENSP00000418156
  • ENST00000488470
  • ENSP00000418378

Symbol
  • KIAA0551
  • MRT54
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.98
molecular function
0.96
small molecule
0.89
transcription factor binding site profile
0.89
interacting protein
0.85


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 30.83   (req: < 5)
Gene RIFs: 16   (req: <= 3)
Antibodies: 518   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 30.83   (req: >= 5)
Gene RIFs: 16   (req: > 3)
Antibodies: 518   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 19
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 104
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 2
Approved Drugs (2)
1 – 2 of 2
sunitinib
chemical structure image
bosutinib
chemical structure image
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (48)
Cellular Senescence (R-HSA-2559583)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cellular Senescence
Reactome
Cellular responses to external stimuli
Reactome
Cellular responses to stress
Reactome
Oxidative Stress Induced Senescence
Name
Explore in Pharos
Explore in Source
Cellular Senescence
Cellular responses to external stimuli
Cellular responses to stress
Oxidative Stress Induced Senescence
Protein-Protein Interactions (45)
1 – 10 of 45
NCK2
Tbio
Novelty: 0.02908657
p_int: 0.999999966
p_ni: 3.2e-8
p_wrong: 2e-9
Score: 0.505
Data Source: BioPlex,STRINGDB
LTBR
Tbio
Novelty: 0.00438925
p_int: 0.999999936
p_ni: 6.4e-8
Data Source: BioPlex
NCK1
Tbio
Novelty: 0.00554007
p_int: 0.999997771
p_ni: 0.000002229
Score: 0.812
Data Source: BioPlex,STRINGDB
KBTBD7
Tdark
Novelty: 1.01449275
p_int: 0.999989064
p_ni: 0.000010814
p_wrong: 1.22e-7
Data Source: BioPlex
IL20RA
Tbio
Novelty: 0.03295383
p_int: 0.999745016
p_ni: 0.000242022
p_wrong: 0.000012962
Score: 0.175
Data Source: BioPlex,STRINGDB
MRPS11
Tdark
Novelty: 0.64495732
p_int: 0.999615264
p_ni: 0.000348858
p_wrong: 0.000035878
Data Source: BioPlex
SPCS3
Tdark
Family: Enzyme
Novelty: 0.25316456
p_int: 0.967442951
p_ni: 0.032495057
p_wrong: 0.000061992
Data Source: BioPlex
CTNNB1
Tchem
Novelty: 0.00008951
Score: 0.955
Data Source: STRINGDB
TRAF2
Tbio
Novelty: 0.01051586
Score: 0.954
Data Source: STRINGDB
TCF7L2
Tbio
Family: TF
Novelty: 0.00205974
Score: 0.948
Data Source: STRINGDB
Publication Statistics
PubMed Score  30.83

PubMed score by year
PubTator Score  21.54

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MASDSPARSLDEIDLSALRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEI
1-70
NMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRG
70-140
LSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATY
140-210
DFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPAT
210-280
EQLMKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTL
280-350
RRDFLRLQLANKERSEALRRQQLEQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQE
350-420
REQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLEILQQQLLHEQALLLEYKRKQLEEQRQAERLQ
420-490
RQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPHKVANRIS
490-560
DPNLPPRSESFSISGVQPARTPPMLRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTS
560-630
HRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLG
630-700
SQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSP
700-770
VLPHEPAKVKPEESRDITRPSRPASYKKAIDEDLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSE
770-840
EEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSG
840-910
EKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPR
910-980
VYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEI
980-1050
LCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRN
1050-1120
RILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQH
1120-1190
KPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYED
1190-1260
EGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCER
1260-1330
NDKVFFASVRSGGSSQVFFMTLNRNSMMNW
1330-1360
MASDSPARSLDEIDLSALRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQLEQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLEILQQQLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSISGVQPARTPPMLRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPASYKKAIDEDLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVFFMTLNRNSMMNW