You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FBXO3
F-box only protein 3

Protein Summary
Description
Substrate recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Mediates the ubiquitination of HIPK2 and probably that of EP300, leading to rapid degradation by the proteasome. In the presence of PML, HIPK2 ubiquitination still occurs, but degradation is prevented. PML, HIPK2 and FBXO3 may act synergically to activate p53/TP53-dependent transactivation. This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternative ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000265651
  • ENSP00000265651
  • ENSG00000110429
  • ENST00000448981
  • ENSP00000408836
  • ENST00000530401
  • ENSP00000433781

Symbol
  • FBX3
  • FBA
  • FBX3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
1
virus perturbation
0.83
histone modification site profile
0.77
microRNA
0.73
cell line
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 43.32   (req: < 5)
Gene RIFs: 9   (req: <= 3)
Antibodies: 128   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 43.32   (req: >= 5)
Gene RIFs: 9   (req: > 3)
Antibodies: 128   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (4)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (54)
1 – 10 of 54
CALHM4
Tdark
Family: IC
p_int: 0.999989253
p_ni: 0.000010448
p_wrong: 2.99e-7
Data Source: BioPlex
ATG9B
Tbio
p_int: 0.999878642
p_ni: 0.00000453
p_wrong: 0.000116828
Data Source: BioPlex
PLCD1
Tchem
Family: Enzyme
Novelty: 0.0084355
p_int: 0.999849887
p_ni: 0.000149478
p_wrong: 6.36e-7
Data Source: BioPlex
DSG4
Tbio
Novelty: 0.00431663
p_int: 0.999808213
p_ni: 0.000191778
p_wrong: 1e-8
Data Source: BioPlex
HEPHL1
Tbio
Novelty: 0.46750499
p_int: 0.999718718
p_ni: 0.000281281
p_wrong: 1e-9
Data Source: BioPlex
TRIM29
Tbio
Novelty: 0.03164477
p_int: 0.998142209
p_ni: 0.001857567
p_wrong: 2.23e-7
Data Source: BioPlex
VSIG8
Tdark
Novelty: 1.45341615
p_int: 0.996275674
p_ni: 0.003159355
p_wrong: 0.000564971
Data Source: BioPlex
S100A3
Tbio
Novelty: 0.0418135
p_int: 0.995343336
p_ni: 0.000087026
p_wrong: 0.004569638
Data Source: BioPlex
LRRC15
Tbio
Novelty: 0.00183551
p_int: 0.977158502
p_ni: 0.022841498
Data Source: BioPlex
DUSP14
Tbio
Family: Enzyme
Novelty: 0.06597118
p_int: 0.965103839
p_ni: 0.034884992
p_wrong: 0.000011169
Data Source: BioPlex
Publication Statistics
PubMed Score  43.32

PubMed score by year
PubTator Score  15.74

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAMETETAPLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQ
1-70
KNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKEGAREEDLDAVEAQIGCKLPD
70-140
DYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGGFQQRQGLKYCLPLTFCIHTGLSQYIAV
140-210
EAAEGRNKNEVFYQCPDQMARNPAAIDMFIIGATFTDWFTSYVKNVVSGGFPIIRDQIFRYVHDPECVAT
210-280
TGDITVSVSTSFLPELSSVHPPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVG
280-350
EFPIISPGRVYEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLEMGPDEY
350-420
EEMEEEEEEEEEEDEDDDSADMDESDEDDEEERRRRVFDVPIRRRRCSRLF
420-471
MAAMETETAPLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQKNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKEGAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFIIGATFTDWFTSYVKNVVSGGFPIIRDQIFRYVHDPECVATTGDITVSVSTSFLPELSSVHPPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGRVYEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLEMGPDEYEEMEEEEEEEEEEDEDDDSADMDESDEDDEEERRRRVFDVPIRRRRCSRLF