You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NAGPA
N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase

Protein Summary
Description
Catalyzes the second step in the formation of the mannose 6-phosphate targeting signal on lysosomal enzyme oligosaccharides by removing GlcNAc residues from GlcNAc-alpha-P-mannose moieties, which are formed in the first step. Also hydrolyzes UDP-GlcNAc, a sugar donor for Golgi N-acetylglucosaminyltransferases. Hydrolases are transported to lysosomes after binding to mannose 6-phosphate receptors in the trans-Golgi network. This gene encodes the enzyme that catalyzes the second step in the formation of the mannose 6-phosphate recognition marker on lysosomal hydrolases. Commonly known as 'uncovering enzyme' or UCE, this enzyme removes N-acetyl-D-glucosamine (GlcNAc) residues from GlcNAc-alpha-P-mannose moieties and thereby produces the recognition marker. The encoded preproprotein is proteolytically processed by furin to generate the mature enzyme, a homotetramer of two disulfide-linked homodimers. Mutations in this gene are associated with developmental stuttering in human patients. [pr ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000312251
  • ENSP00000310998
  • ENSG00000103174
  • ENST00000381955
  • ENSP00000371381
  • ENST00000562746
  • ENSP00000455900
  • ENST00000649828
  • ENSP00000498032

Symbol
  • UCE
  • APAA
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.88
kinase perturbation
0.84
disease perturbation
0.74
transcription factor binding site profile
0.73
cellular component
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 120.96   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 34   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 120.96   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 34   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (57)
1 – 10 of 57
NGLY1
Tbio
Family: Enzyme
Novelty: 0.01050838
p_int: 0.994181736
p_ni: 0.005818264
Score: 0.221
Data Source: BioPlex,STRINGDB
TYW3
Tdark
Novelty: 0.28985507
p_int: 0.994055245
p_ni: 0.00594084
p_wrong: 0.000003915
Data Source: BioPlex
FADS3
Tbio
Family: Enzyme
Novelty: 0.05947668
p_int: 0.981643709
p_ni: 0.018356144
p_wrong: 1.47e-7
Score: 0.175
Data Source: BioPlex,STRINGDB
FSHR
Tclin
Family: GPCR
Novelty: 0.00142021
p_int: 0.961821461
p_ni: 0.037729931
p_wrong: 0.000448608
Score: 0.179
Data Source: BioPlex,STRINGDB
UBR3
Tbio
Family: Enzyme
Novelty: 0.11338583
p_int: 0.953316232
p_ni: 0.046683768
Data Source: BioPlex
SLAMF7
Tclin
Novelty: 0.01669532
p_int: 0.952203956
p_ni: 0.047796044
Score: 0.295
Data Source: BioPlex,STRINGDB
ABCD4
Tbio
Family: Transporter
Novelty: 0.05184221
p_int: 0.93779349
p_ni: 0.061200411
p_wrong: 0.001006098
Data Source: BioPlex
AP2M1
Tbio
Novelty: 0.01240983
p_int: 0.863775085
p_ni: 0.136224849
p_wrong: 6.7e-8
Data Source: BioPlex
ADGRE5
Tbio
Family: GPCR
Novelty: 0.01324684
p_int: 0.797029268
p_ni: 0.20297055
p_wrong: 1.82e-7
Data Source: BioPlex
WDR54
Tdark
Novelty: 1.5
p_int: 0.788562343
p_ni: 0.211437656
p_wrong: 1e-9
Score: 0.185
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  120.96

PubMed score by year
PubTator Score  27.45

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MATSTGRWLLLRLALFGFLWEASGGLDSGASRDDDLLLPYPRARARLPRDCTRVRAGNREHESWPPPPAT
1-70
PGAGGLAVRTFVSHFRDRAVAGHLTRAVEPLRTFSVLEPGGPGGCAARRRATVEETARAADCRVAQNGGF
70-140
FRMNSGECLGNVVSDERRVSSSGGLQNAQFGIRRDGTLVTGYLSEEEVLDTENPFVQLLSGVVWLIRNGS
140-210
IYINESQATECDETQETGSFSKFVNVISARTAIGHDRKGQLVLFHADGQTEQRGINLWEMAEFLLKQDVV
210-280
NAINLDGGGSATFVLNGTLASYPSDHCQDNMWRCPRQVSTVVCVHEPRCQPPDCHGHGTCVDGHCQCTGH
280-350
FWRGPGCDELDCGPSNCSQHGLCTETGCRCDAGWTGSNCSEECPLGWHGPGCQRPCKCEHHCPCDPKTGN
350-420
CSVSRVKQCLQPPEATLRAGELSFFTRTAWLALTLALAFLLLISTAANLSLLLSRAERNRRLHGDYAYHP
420-490
LQEMNGEPLAAEKEQPGGAHNPFKD
490-515
MATSTGRWLLLRLALFGFLWEASGGLDSGASRDDDLLLPYPRARARLPRDCTRVRAGNREHESWPPPPATPGAGGLAVRTFVSHFRDRAVAGHLTRAVEPLRTFSVLEPGGPGGCAARRRATVEETARAADCRVAQNGGFFRMNSGECLGNVVSDERRVSSSGGLQNAQFGIRRDGTLVTGYLSEEEVLDTENPFVQLLSGVVWLIRNGSIYINESQATECDETQETGSFSKFVNVISARTAIGHDRKGQLVLFHADGQTEQRGINLWEMAEFLLKQDVVNAINLDGGGSATFVLNGTLASYPSDHCQDNMWRCPRQVSTVVCVHEPRCQPPDCHGHGTCVDGHCQCTGHFWRGPGCDELDCGPSNCSQHGLCTETGCRCDAGWTGSNCSEECPLGWHGPGCQRPCKCEHHCPCDPKTGNCSVSRVKQCLQPPEATLRAGELSFFTRTAWLALTLALAFLLLISTAANLSLLLSRAERNRRLHGDYAYHPLQEMNGEPLAAEKEQPGGAHNPFKD