You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
KCND3
Potassium voltage-gated channel subfamily D member 3

Protein Summary
Description
Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I(To) current in heart and I(Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000302127
  • ENSP00000306923
  • ENSG00000171385
  • ENST00000315987
  • ENSP00000319591
  • ENST00000369697
  • ENSP00000358711

Symbol
  • KV4.3
  • SCA19
  • SCA22
  • BRGDA9
  • KCND3L
  • KCND3S
  • KSHIVB
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
1
molecular function
0.94
disease perturbation
0.68
PubMedID
0.64
transcription factor
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 226.19   (req: < 5)
Gene RIFs: 40   (req: <= 3)
Antibodies: 200   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 226.19   (req: >= 5)
Gene RIFs: 40   (req: > 3)
Antibodies: 200   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 3
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 7
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (6)
Cardiac conduction (R-HSA-5576891)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cardiac conduction
Reactome
Muscle contraction
Reactome
Neuronal System
Reactome
Phase 1 - inactivation of fast Na+ channels
Reactome
Potassium Channels
Name
Explore in Pharos
Explore in Source
Cardiac conduction
Muscle contraction
Neuronal System
Phase 1 - inactivation of fast Na+ channels
Potassium Channels
Protein-Protein Interactions (184)
1 – 10 of 184
KCNIP1
Tbio
Family: IC
Novelty: 0.02615849
Score: 0.998
Data Source: Reactome,STRINGDB
KCNIP2
Tbio
Family: IC
Novelty: 0.0124069
Score: 0.998
Data Source: Reactome,STRINGDB
KCNIP4
Tbio
Family: IC
Novelty: 0.01754679
Score: 0.983
Data Source: Reactome,STRINGDB
KCNIP3
Tbio
Family: IC
Novelty: 0.01703185
Score: 0.978
Data Source: Reactome,STRINGDB
KCNAB1
Tbio
Family: IC
Novelty: 0.01799224
Score: 0.965
Data Source: STRINGDB
KCNAB2
Tbio
Family: IC
Novelty: 0.02072106
Score: 0.962
Data Source: STRINGDB
KCNAB3
Tbio
Family: IC
Novelty: 0.16424117
Score: 0.943
Data Source: STRINGDB
KCNH2
Tclin
Family: IC
Novelty: 0.00059104
Score: 0.879
Data Source: STRINGDB
NCS1
Tbio
Novelty: 0.00364462
Score: 0.85
Data Source: STRINGDB
DPP6
Tbio
Family: Enzyme
Novelty: 0.00786368
Score: 0.836
Data Source: STRINGDB
Publication Statistics
PubMed Score  226.19

PubMed score by year
PubTator Score  225.48

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLERYPDTLLGSTE
1-70
KEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAFYGILPEIIGDCCYEEYKDRK
70-140
RENAERLMDDNDSENNQESMPSLSFRQTMWRAFENPHTSTLALVFYYVTGFFIAVSVITNVVETVPCGTV
140-210
PGSKELPCGERYSVAFFCLDTACVMIFTVEYLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNE
210-280
DVSGAFVTLRVFRVFRIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASK
280-350
FTSIPASFWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRR
350-420
AQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLLHCLEKTTGLS
420-490
YLVDDPLLSVRTSTIKNHEFIDEQMFEQNCMESSMQNYPSTRSPSLSSHPGLTTTCCSRRSKKTTHLPNS
490-560
NLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDGLRPNCKTSQITTAIISIPTPPALTPEGESR
560-630
PPPASPGPNTNIPSIASNVVKVSAL
630-655
MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLERYPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAFYGILPEIIGDCCYEEYKDRKRENAERLMDDNDSENNQESMPSLSFRQTMWRAFENPHTSTLALVFYYVTGFFIAVSVITNVVETVPCGTVPGSKELPCGERYSVAFFCLDTACVMIFTVEYLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNEDVSGAFVTLRVFRVFRIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPASFWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRRAQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLLHCLEKTTGLSYLVDDPLLSVRTSTIKNHEFIDEQMFEQNCMESSMQNYPSTRSPSLSSHPGLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDGLRPNCKTSQITTAIISIPTPPALTPEGESRPPPASPGPNTNIPSIASNVVKVSAL