You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
STOML2
Stomatin-like protein 2, mitochondrial

Protein Summary
Description
Mitochondrial protein that probably regulates the biogenesis and the activity of mitochondria. Stimulates cardiolipin biosynthesis, binds cardiolipin-enriched membranes where it recruits and stabilizes some proteins including prohibitin and may therefore act in the organization of functional microdomains in mitochondrial membranes. Through regulation of the mitochondrial function may play a role into several biological processes including cell migration, cell proliferation, T-cell activation, calcium homeostasis and cellular response to stress. May play a role in calcium homeostasis through negative regulation of calcium efflux from mitochondria. Required for mitochondrial hyperfusion a pro-survival cellular response to stress which results in increased ATP production by mitochondria. May also regulate the organization of functional domains at the plasma membrane and play a role in T-cell activation through association with the T-cell receptor signaling complex and its regulation.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000356493
  • ENSP00000348886
  • ENSG00000165283
  • ENST00000452248
  • ENSP00000395743

Symbol
  • SLP2
  • SLP-2
  • HSPC108
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
interacting protein
0.99
disease perturbation
0.95
kinase perturbation
0.84
histone modification site profile
0.8


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 11.66   (req: < 5)
Gene RIFs: 35   (req: <= 3)
Antibodies: 234   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 11.66   (req: >= 5)
Gene RIFs: 35   (req: > 3)
Antibodies: 234   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 17
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (3)
Mitochondrial calcium ion transport (R-HSA-8949215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Mitochondrial calcium ion transport
Reactome
Processing of SMDT1
Reactome
Transport of small molecules
Name
Explore in Pharos
Explore in Source
Mitochondrial calcium ion transport
Processing of SMDT1
Transport of small molecules
Gene Ontology Terms (22)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (80)
1 – 10 of 80
PRKAR1A
Tbio
Family: Enzyme
Novelty: 0.00372136
p_int: 0.97291273
p_ni: 0.02708727
Score: 0.545
Data Source: BioPlex,STRINGDB
PHB2
Tbio
Novelty: 0.00467021
Score: 0.934
Data Source: STRINGDB
YME1L1
Tbio
Family: Enzyme
Novelty: 0.0027355
Score: 0.926
Data Source: Reactome,STRINGDB
PHB
Tbio
Novelty: 0.001936
Score: 0.916
Data Source: STRINGDB
PARL
Tbio
Family: Enzyme
Novelty: 0.02655644
Score: 0.915
Data Source: Reactome,STRINGDB
SMDT1
Tbio
Novelty: 0.02130362
Score: 0.906
Data Source: STRINGDB
ATP5F1A
Tbio
Family: Enzyme
Novelty: 0.00712157
Score: 0.887
Data Source: STRINGDB
MRPL32
Tdark
Novelty: 1.5
Score: 0.879
Data Source: STRINGDB
MRPL40
Tbio
Novelty: 0.07681266
Score: 0.852
Data Source: STRINGDB
HSPA1L
Tbio
Novelty: 0.02076021
Score: 0.836
Data Source: STRINGDB
Publication Statistics
PubMed Score  11.66

PubMed score by year
PubTator Score  42.47

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLARAARGTGALLLRGSLLASGRAPRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILEPGLNILIPVL
1-70
DRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVEDPEYAVTQLAQTTMRSELGK
70-140
LSLDKVFRERESLNASIVDAINQAADCWGIRCLRYEIKDIHVPPRVKESMQMQVEAERRKRATVLESEGT
140-210
RESAINVAEGKKQAQILASEAEKAEQINQAAGEASAVLAKAKAKAEAIRILAAALTQHNGDAAASLTVAE
210-280
QYVSAFSKLAKDSNTILLPSNPGDVTSMVAQAMGVYGALTKAPVPGTPDSLSSGSSRDVQGTDASLDEEL
280-350
DRVKMS
350-356
MLARAARGTGALLLRGSLLASGRAPRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILEPGLNILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVEDPEYAVTQLAQTTMRSELGKLSLDKVFRERESLNASIVDAINQAADCWGIRCLRYEIKDIHVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQAQILASEAEKAEQINQAAGEASAVLAKAKAKAEAIRILAAALTQHNGDAAASLTVAEQYVSAFSKLAKDSNTILLPSNPGDVTSMVAQAMGVYGALTKAPVPGTPDSLSSGSSRDVQGTDASLDEELDRVKMS