You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ANAPC7
Anaphase-promoting complex subunit 7

Protein Summary
Description
Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. This gene encodes a tetratricopeptide repeat containing component of the anaphase promoting complex/cyclosome (APC/C), a large E3 ubiquitin ligase that controls cell cycle progression by targeting a number of cell cycle regulators such as B-type cyclins for 26S proteasome-mediated degradation through ubiquitination. The encoded protein is required for proper protein ubiquitination function of APC/C and for the interaction of APC/C with certain transcription coactivators. Multiple transcript variants encoding different isoforms have been found for ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000450008
  • ENSP00000402314
  • ENSG00000196510
  • ENST00000455511
  • ENSP00000394394

Symbol
  • APC7
  • APC7
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.94
interacting protein
0.91
histone modification site profile
0.9
kinase perturbation
0.76
virus perturbation
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.45   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 87   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.45   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 87   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (10)
1 – 5 of 10
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (45)
APC-Cdc20 mediated degradation of Nek2A (R-HSA-179409)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 37
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
APC-Cdc20 mediated degradation of Nek2A
Reactome
APC/C-mediated degradation of cell cycle proteins
Reactome
APC/C:Cdc20 mediated degradation of Cyclin B
Reactome
APC/C:Cdc20 mediated degradation of Securin
Reactome
APC/C:Cdc20 mediated degradation of mitotic proteins
Name
Explore in Pharos
Explore in Source
APC-Cdc20 mediated degradation of Nek2A
APC/C-mediated degradation of cell cycle proteins
APC/C:Cdc20 mediated degradation of Cyclin B
APC/C:Cdc20 mediated degradation of Securin
APC/C:Cdc20 mediated degradation of mitotic proteins
Gene Ontology Terms (10)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
BHF-UCL
Protein-Protein Interactions (426)
1 – 10 of 426
ANAPC5
Tbio
Family: Enzyme
Novelty: 0.0345899
p_int: 0.999956101
p_ni: 0.000043899
Score: 0.999
Data Source: BioPlex,STRINGDB
ANAPC16
Tdark
Family: Enzyme
Novelty: 0.09302326
p_int: 0.999886888
p_ni: 0.000113112
Score: 0.999
Data Source: BioPlex,STRINGDB
ANAPC13
Tbio
Family: Enzyme
Novelty: 0.0994907
p_int: 0.999780961
p_ni: 0.000219039
Score: 0.999
Data Source: BioPlex,STRINGDB
CDC26
Tbio
Family: Enzyme
Novelty: 0.12631579
p_int: 0.999693511
p_ni: 0.000306489
Score: 0.999
Data Source: BioPlex,STRINGDB
C16orf87
Tdark
p_int: 0.996558215
p_ni: 0.003441785
Score: 0.795
Data Source: BioPlex,STRINGDB
CDC16
Tbio
Novelty: 0.01336597
p_int: 0.986484125
p_ni: 0.013515872
p_wrong: 3e-9
Score: 0.999
Data Source: BioPlex,STRINGDB
MAGIX
Tdark
Novelty: 0.09090909
p_int: 0.968005166
p_ni: 0.031994834
Score: 0.795
Data Source: BioPlex,STRINGDB
LAMP1
Tbio
Novelty: 0.00104159
p_int: 0.790476045
p_ni: 0.20952395
p_wrong: 4e-9
Score: 0.189
Data Source: BioPlex,STRINGDB
C6orf222
Tdark
p_int: 0.787036094
p_ni: 0.212963906
Data Source: BioPlex
ANAPC10
Tbio
Family: Enzyme
Novelty: 0.04372723
Score: 0.999
Data Source: STRINGDB
Publication Statistics
PubMed Score  2.45

PubMed score by year
PubTator Score  11.93

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDPGDAAILESSLRILYRLFESVLPPLPAALQSRMNVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPEL
1-70
FSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKVRPSTGNSASTPQSQCLPSEIEVKY
70-140
KMAECYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYKKAGQERPSVTSYKEVLRQCPLALDAILGLL
140-210
SLSVKGAEVASMTMNVIQTVPNLDWLSVWIKAYAFVHTGDNSRAISTICSLEKKSLLRDNVDLLGSLADL
210-280
YFRAGDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSF
280-350
YSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLAS
350-420
NSIREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALTQRPDYIKAVVKKAELLSREQ
420-490
KYEDGIALLRNALANQSDCVLHRILGDFLVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTD
490-560
ATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQWFGMQ
560-599
MDPGDAAILESSLRILYRLFESVLPPLPAALQSRMNVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPELFSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKVRPSTGNSASTPQSQCLPSEIEVKYKMAECYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYKKAGQERPSVTSYKEVLRQCPLALDAILGLLSLSVKGAEVASMTMNVIQTVPNLDWLSVWIKAYAFVHTGDNSRAISTICSLEKKSLLRDNVDLLGSLADLYFRAGDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLASNSIREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALTQRPDYIKAVVKKAELLSREQKYEDGIALLRNALANQSDCVLHRILGDFLVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQWFGMQ