You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CDC23
Cell division cycle protein 23 homolog

Protein Summary
Description
Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eukaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repea ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000394884
  • ENSP00000378348
  • ENSG00000094880
  • ENST00000394886
  • ENSP00000378350

Symbol
  • ANAPC8
  • APC8
  • CUT23
  • ANAPC8
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
1
biological process
0.96
virus perturbation
0.96
histone modification site profile
0.88
disease perturbation
0.83


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 37.3   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 267   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 37.3   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 267   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (9)
1 – 5 of 9
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (72)
APC-Cdc20 mediated degradation of Nek2A (R-HSA-179409)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 37
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
APC-Cdc20 mediated degradation of Nek2A
Reactome
APC/C-mediated degradation of cell cycle proteins
Reactome
APC/C:Cdc20 mediated degradation of Cyclin B
Reactome
APC/C:Cdc20 mediated degradation of Securin
Reactome
APC/C:Cdc20 mediated degradation of mitotic proteins
Name
Explore in Pharos
Explore in Source
APC-Cdc20 mediated degradation of Nek2A
APC/C-mediated degradation of cell cycle proteins
APC/C:Cdc20 mediated degradation of Cyclin B
APC/C:Cdc20 mediated degradation of Securin
APC/C:Cdc20 mediated degradation of mitotic proteins
Gene Ontology Terms (15)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
UniProtKB
Protein-Protein Interactions (478)
1 – 10 of 478
ANAPC13
Tbio
Family: Enzyme
Novelty: 0.0994907
p_int: 0.999998592
p_ni: 0.000001407
p_wrong: 1e-9
Score: 0.999
Data Source: BioPlex,STRINGDB
CDC26
Tbio
Family: Enzyme
Novelty: 0.12631579
p_int: 0.999997546
p_ni: 0.000002454
Score: 0.999
Data Source: BioPlex,STRINGDB
ANAPC5
Tbio
Family: Enzyme
Novelty: 0.0345899
p_int: 0.99999748
p_ni: 0.000002516
p_wrong: 4e-9
Score: 0.999
Data Source: BioPlex,STRINGDB
CDC16
Tbio
Novelty: 0.01336597
p_int: 0.999996688
p_ni: 0.000003312
Score: 0.999
Data Source: BioPlex,STRINGDB
ANAPC16
Tdark
Family: Enzyme
Novelty: 0.09302326
p_int: 0.999991546
p_ni: 0.000008453
p_wrong: 1e-9
Score: 0.999
Data Source: BioPlex,STRINGDB
C16orf87
Tdark
p_int: 0.999981592
p_ni: 0.000018405
p_wrong: 3e-9
Score: 0.321
Data Source: BioPlex,STRINGDB
MAGIX
Tdark
Novelty: 0.09090909
p_int: 0.999922343
p_ni: 0.000077657
Score: 0.155
Data Source: BioPlex,STRINGDB
FZR1
Tbio
Novelty: 0.01409033
p_int: 0.998477496
p_ni: 0.001522504
Score: 0.999
Data Source: BioPlex,STRINGDB
PENK
Tbio
Novelty: 0.00085036
p_int: 0.998173061
p_ni: 0.001826937
p_wrong: 1e-9
Score: 0.204
Data Source: BioPlex,STRINGDB
SCGN
Tbio
Novelty: 0.01547867
p_int: 0.997060247
p_ni: 0.002939752
p_wrong: 2e-9
Data Source: BioPlex
Publication Statistics
PubMed Score  37.30

PubMed score by year
PubTator Score  14.01

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAASTSMVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAFSLPALPLAEL
1-70
QPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGP
70-140
LEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLRKLDLVKEAIDVFVEATHVLPLHWGAWLELC
140-210
NLITDKEMLKFLSLPDTWMKEFFLAHIYTELQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDID
210-280
KALSIFNELRKQDPYRIENMDTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKA
280-350
ALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
350-420
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLTESEQAAQCY
420-490
IKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFNDTREEGKALLRQILQLRNQG
490-560
ETPTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP
560-597
MAASTSMVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAFSLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLRKLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTELQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLTESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFNDTREEGKALLRQILQLRNQGETPTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP