You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SERPINB13
Serpin B13

Protein Summary
Description
May play a role in the proliferation or differentiation of keratinocytes. The protein encoded by this gene is a member of the serpin family of serine protease inhibitors. The encoded protein inhibits the activity of cathepsin K and is itself transcriptionally repressed by RUNX1. This gene is downregulated in many types of cancer. [provided by RefSeq, Jan 2017]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000344731
  • ENSP00000341584
  • ENSG00000197641

Symbol
  • PI13
  • HUR7
  • PI13
  • headpin
  • HSHUR7SEQ
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.71
kinase perturbation
0.71
virus perturbation
0.64
interacting protein
0.61
gene perturbation
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 35.98   (req: < 5)
Gene RIFs: 9   (req: <= 3)
Antibodies: 190   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 35.98   (req: >= 5)
Gene RIFs: 9   (req: > 3)
Antibodies: 190   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (6)
Gene expression (Transcription) (R-HSA-74160)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
RNA Polymerase II Transcription
Reactome
RUNX1 regulates transcription of genes involved in differentiation of keratinocytes
Reactome
Transcriptional regulation by RUNX1
Name
Explore in Pharos
Explore in Source
Gene expression (Transcription)
Generic Transcription Pathway
RNA Polymerase II Transcription
RUNX1 regulates transcription of genes involved in differentiation of keratinocytes
Transcriptional regulation by RUNX1
Protein-Protein Interactions (48)
1 – 10 of 48
ROR1
Tbio
Family: Kinase
Novelty: 0.03491998
p_int: 0.999996804
p_ni: 0.00000311
p_wrong: 8.5e-8
Score: 0.29
Data Source: BioPlex,STRINGDB
BSDC1
Tdark
Novelty: 5
p_int: 0.999991454
p_ni: 8e-9
p_wrong: 0.000008538
Score: 0.291
Data Source: BioPlex,STRINGDB
BRAP
Tbio
Novelty: 0.04388873
p_int: 0.999972571
p_ni: 0.000027414
p_wrong: 1.4e-8
Score: 0.202
Data Source: BioPlex,STRINGDB
C1orf198
Tdark
Novelty: 2
p_int: 0.999808766
p_ni: 0.000182099
p_wrong: 0.000009135
Data Source: BioPlex
RNF34
Tbio
Family: Enzyme
Novelty: 0.00281563
p_int: 0.999317273
p_ni: 0.000088047
p_wrong: 0.00059468
Score: 0.185
Data Source: BioPlex,STRINGDB
RBM14
Tbio
Novelty: 0.00695569
p_int: 0.998947061
p_ni: 0.001051393
p_wrong: 0.000001547
Data Source: BioPlex
RBM24
Tbio
Novelty: 0.05713269
p_int: 0.995312346
p_ni: 0.004687635
p_wrong: 1.9e-8
Score: 0.187
Data Source: BioPlex,STRINGDB
C9orf78
Tdark
Novelty: 0.87993554
p_int: 0.990237822
p_ni: 0.005838345
p_wrong: 0.003923833
Data Source: BioPlex
TTC4
Tbio
Novelty: 0.01189394
p_int: 0.989425344
p_ni: 0.010574655
Score: 0.173
Data Source: BioPlex,STRINGDB
ADD2
Tbio
Family: Enzyme
Novelty: 0.00893667
p_int: 0.988063175
p_ni: 0.011936172
p_wrong: 6.53e-7
Data Source: BioPlex
Publication Statistics
PubMed Score  35.98

PubMed score by year
PubTator Score  15.84

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDSLGAVSTRLGFDLFKELKKTNDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIKA
1-70
EEKEVIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNA
70-140
ADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKGQWDREFKKENTKEEKFWMNKSTSKS
140-210
VQMMTQSHSFSFTFLEDLQAKILGIPYKNNDLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERK
210-280
VNLHLPRFEVEDGYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATG
280-350
IGFTVTSAPGHENVHCNHPFLFFIRHNESNSILFFGRFSSP
350-391
MDSLGAVSTRLGFDLFKELKKTNDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIKAEEKEVIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNAADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKGQWDREFKKENTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQAKILGIPYKNNDLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERKVNLHLPRFEVEDGYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATGIGFTVTSAPGHENVHCNHPFLFFIRHNESNSILFFGRFSSP