You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
LNPEP
Leucyl-cystinyl aminopeptidase

Protein Summary
Description
Release of an N-terminal amino acid, cleaves before cysteine, leucine as well as other amino acids. Degrades peptide hormones such as oxytocin, vasopressin and angiotensin III, and plays a role in maintaining homeostasis during pregnancy. May be involved in the inactivation of neuronal peptides in the brain. Cleaves Met-enkephalin and dynorphin. Binds angiotensin IV and may be the angiotensin IV receptor in the brain. This gene encodes a zinc-dependent aminopeptidase that cleaves vasopressin, oxytocin, lys-bradykinin, met-enkephalin, dynorphin A and other peptide hormones. The protein can be secreted in maternal serum, reside in intracellular vesicles with the insulin-responsive glucose transporter GLUT4, or form a type II integral membrane glycoprotein. The protein catalyzes the final step in the conversion of angiotensinogen to angiotensin IV (AT4) and is also a receptor for AT4. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by Re ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000231368
  • ENSP00000231368
  • ENSG00000113441
  • ENST00000395770
  • ENSP00000379117

Symbol
  • OTASE
  • CAP
  • IRAP
  • PLAP
  • P-LAP
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.99
transcription factor binding site profile
0.98
transcription factor perturbation
0.91
histone modification site profile
0.87
small molecule perturbation
0.75


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 397.01   (req: < 5)
Gene RIFs: 37   (req: <= 3)
Antibodies: 129   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 397.01   (req: >= 5)
Gene RIFs: 37   (req: > 3)
Antibodies: 129   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 43
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (12)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Antigen processing-Cross presentation
Reactome
Antigen processing: Ubiquitination & Proteasome degradation
Reactome
Class I MHC mediated antigen processing & presentation
Reactome
Endosomal/Vacuolar pathway
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Antigen processing-Cross presentation
Antigen processing: Ubiquitination & Proteasome degradation
Class I MHC mediated antigen processing & presentation
Endosomal/Vacuolar pathway
Protein-Protein Interactions (184)
1 – 10 of 184
BTNL8
Tdark
Novelty: 0.35087719
p_int: 0.999638298
p_ni: 0.000361702
Data Source: BioPlex
LGALS8
Tchem
Novelty: 0.00746585
p_int: 0.999512865
p_ni: 0.000487135
Data Source: BioPlex
LGALS9
Tchem
Novelty: 0.00463223
p_int: 0.999282041
p_ni: 0.000717959
Data Source: BioPlex
LGALS3
Tchem
Novelty: 0.00032884
p_int: 0.998618103
p_ni: 0.001381897
Data Source: BioPlex
LMAN2L
Tbio
Novelty: 0.01832061
p_int: 0.99396913
p_ni: 0.00603087
Score: 0.152
Data Source: BioPlex,STRINGDB
TMEM267
Tdark
p_int: 0.989572715
p_ni: 0.010427285
Score: 0.187
Data Source: BioPlex,STRINGDB
SCGB1D4
Tdark
Novelty: 0.00109728
p_int: 0.988581365
p_ni: 0.011418635
Data Source: BioPlex
CYP2J2
Tchem
Novelty: 0.00634057
p_int: 0.987780078
p_ni: 0.012219922
Data Source: BioPlex
EDNRB
Tclin
Family: GPCR
Novelty: 0.00055047
p_int: 0.982495365
p_ni: 0.017504635
Data Source: BioPlex
SIAE
Tbio
Family: Enzyme
Novelty: 0.00505798
p_int: 0.979049072
p_ni: 0.020950928
Data Source: BioPlex
Publication Statistics
PubMed Score  397.01

PubMed score by year
PubTator Score  495.07

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEPFTNDRLQLPRNMIENSMFEEEPDVVDLAKEPCLHPLEPDEVEYEPRGSRLLVRGLGEHEMEEDEEDY
1-70
ESSAKLLGMSFMNRSSGLRNSATGYRQSPDGACSVPSARTMVVCAFVIVVAVSVIMVIYLLPRCTFTKEG
70-140
CHKKNQSIGLIQPFATNGKLFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILH
140-210
STGHNISRVTFMSAVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYT
210-280
DESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSE
280-350
SVKMSTYLVAFIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLV
350-420
AIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFA
420-490
TFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLK
490-560
TYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQTLDVKRMMKTWTLQKGFPLVTVQKKGKELFI
560-630
QQERFFLNMKPEIQPSDTSYLWHIPLSYVTEGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYY
630-700
IVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALF
700-770
QTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAM
770-840
KLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASSEDVRKLYWLM
840-910
KSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFSTKTHL
910-980
SEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL
980-1025
MEPFTNDRLQLPRNMIENSMFEEEPDVVDLAKEPCLHPLEPDEVEYEPRGSRLLVRGLGEHEMEEDEEDYESSAKLLGMSFMNRSSGLRNSATGYRQSPDGACSVPSARTMVVCAFVIVVAVSVIMVIYLLPRCTFTKEGCHKKNQSIGLIQPFATNGKLFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSAVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVAIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQTLDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMKPEIQPSDTSYLWHIPLSYVTEGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASSEDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL