You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FKBPL
FK506-binding protein-like

Protein Summary
Description
May be involved in response to X-ray. Regulates p21 protein stability by binding to Hsp90 and p21. The protein encoded by this gene has similarity to the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The encoded protein is thought to have a potential role in the induced radioresistance. Also it appears to have some involvement in the control of the cell cycle. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000375156
  • ENSP00000364298
  • ENSG00000204315
  • ENST00000425378
  • ENSP00000397530
  • ENSG00000230907
  • ENST00000443350
  • ENSP00000398812
  • ENSG00000223666
  • ENST00000456854
  • ENSP00000412439
  • ENSG00000224200

Symbol
  • DIR1
  • NG7
  • NG7
  • DIR1
  • FKBP4
  • WISP39
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.73
protein domain
0.73
disease perturbation
0.68
transcription factor binding site profile
0.68
tissue sample
0.67


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 32.55   (req: < 5)
Gene RIFs: 12   (req: <= 3)
Antibodies: 240   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 32.55   (req: >= 5)
Gene RIFs: 12   (req: > 3)
Antibodies: 240   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (5)
Cell Cycle (R-HSA-1640170)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell Cycle
Reactome
Cell Cycle, Mitotic
Reactome
G2/M Transition
Reactome
Mitotic G2-G2/M phases
Reactome
The role of GTSE1 in G2/M progression after G2 checkpoint
Name
Explore in Pharos
Explore in Source
Cell Cycle
Cell Cycle, Mitotic
G2/M Transition
Mitotic G2-G2/M phases
The role of GTSE1 in G2/M progression after G2 checkpoint
Gene Ontology Terms (5)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Traceable Author Statement (TAS)
Reactome
Protein-Protein Interactions (45)
1 – 10 of 45
ANKRD49
Tbio
Novelty: 0.01347961
p_int: 1
Score: 0.87
Data Source: BioPlex,STRINGDB
NADSYN1
Tbio
Family: Enzyme
Novelty: 0.05610136
p_int: 0.999997595
p_ni: 1.96e-7
p_wrong: 0.000002209
Score: 0.297
Data Source: BioPlex,STRINGDB
RBCK1
Tbio
Novelty: 0.02344672
p_int: 0.999954158
p_ni: 0.000037712
p_wrong: 0.000008129
Score: 0.765
Data Source: BioPlex,STRINGDB
BRAF
Tclin
Family: Kinase
Novelty: 0.00382184
p_int: 0.999448956
p_ni: 0.000551004
p_wrong: 3.9e-8
Score: 0.23
Data Source: BioPlex,STRINGDB
RNF31
Tbio
Family: Enzyme
Novelty: 0.01498949
p_int: 0.996798311
p_ni: 0.00319174
p_wrong: 0.000009949
Score: 0.42
Data Source: BioPlex,STRINGDB
CSNK1E
Tchem
Family: Kinase
Novelty: 0.00998717
p_int: 0.985084914
p_ni: 0.014915086
Score: 0.477
Data Source: BioPlex,STRINGDB
PLS1
Tbio
Novelty: 0.0040352
p_int: 0.983926715
p_ni: 0.016073279
p_wrong: 6e-9
Score: 0.168
Data Source: BioPlex,STRINGDB
EDRF1
Tdark
Novelty: 0.32061069
p_int: 0.982629749
p_ni: 0.017370178
p_wrong: 7.3e-8
Score: 0.183
Data Source: BioPlex,STRINGDB
CSNK1D
Tchem
Family: Kinase
Novelty: 0.00585669
p_int: 0.980951397
p_ni: 0.0190486
p_wrong: 3e-9
Score: 0.68
Data Source: BioPlex,STRINGDB
CTU1
Tbio
Novelty: 0.06213937
p_int: 0.760820341
p_ni: 0.230146926
p_wrong: 0.009032733
Score: 0.252
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  32.55

PubMed score by year
PubTator Score  39.96

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELEVSPDPASQILEHTQGAEKLV
1-70
AELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKLGSCCRVLALGFPFGSGPPEG
70-140
WTELTMGVGPWREETWGELIEKCLESMCQGEEAELQLPGHSGPPVRLTLASFTQGRDSWELETSEKEALA
140-210
REERARGTELFRAGNPEGAARCYGRALRLLLTLPPPGPPERTVLHANLAACQLLLGQPQLAAQSCDRVLE
210-280
REPGHLKALYRRGVAQAALGNLEKATADLKKVLAIDPKNRAAQEELGKVVIQGKNQDAGLAQGLRKMFG
280-349
METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELEVSPDPASQILEHTQGAEKLVAELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKLGSCCRVLALGFPFGSGPPEGWTELTMGVGPWREETWGELIEKCLESMCQGEEAELQLPGHSGPPVRLTLASFTQGRDSWELETSEKEALAREERARGTELFRAGNPEGAARCYGRALRLLLTLPPPGPPERTVLHANLAACQLLLGQPQLAAQSCDRVLEREPGHLKALYRRGVAQAALGNLEKATADLKKVLAIDPKNRAAQEELGKVVIQGKNQDAGLAQGLRKMFG