You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
ASIC3
Acid-sensing ion channel 3

Protein Summary
Description
Cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. Generates a biphasic current with a fast inactivating and a slow sustained phase. In sensory neurons is proposed to mediate the pain induced by acidosis that occurs in ischemic, damaged or inflamed tissue. May be involved in hyperalgesia. May play a role in mechanoreception. Heteromeric channel assembly seems to modulate channel properties. This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, two hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene is an acid sensor and may play an important role in the detection of lasting pH changes. In addition, a heteromeric association between this member and acid-sensing ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000297512
  • ENSP00000297512
  • ENSG00000213199
  • ENST00000349064
  • ENSP00000344838
  • ENST00000357922
  • ENSP00000350600
  • ENST00000377904
  • ENSP00000367136
  • ENST00000468325
  • ENSP00000418605

Symbol
  • ACCN3
  • SLNAC1
  • TNAC1
  • ACCN3
  • TNaC1
  • DRASIC
  • SLNAC1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.88
cell type or tissue
0.65
tissue sample
0.61
cellular component
0.6
disease perturbation
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 215.78   (req: < 5)
Gene RIFs: 27   (req: <= 3)
Antibodies: 160   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 215.78   (req: >= 5)
Gene RIFs: 27   (req: > 3)
Antibodies: 160   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 37
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 4
Pathways (4)
Ion channel transport (R-HSA-983712)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Ion channel transport
Reactome
Stimuli-sensing channels
Reactome
Transport of small molecules
Name
Explore in Pharos
Explore in Source
Ion channel transport
Stimuli-sensing channels
Transport of small molecules
Protein-Protein Interactions (42)
1 – 10 of 42
STOM
Tbio
Novelty: 0.00472127
Score: 0.969
Data Source: STRINGDB
STOML3
Tbio
Novelty: 0.00322259
Score: 0.958
Data Source: Reactome,STRINGDB
TRPV1
Tclin
Family: IC
Novelty: 0.00052256
Score: 0.826
Data Source: STRINGDB
PICK1
Tbio
Novelty: 0.00686801
Score: 0.757
Data Source: STRINGDB
NGF
Tchem
Novelty: 0.00009278
Score: 0.713
Data Source: STRINGDB
PATJ
Tbio
Novelty: 0.01031284
Score: 0.707
Data Source: STRINGDB
TRPA1
Tclin
Family: IC
Novelty: 0.00104738
Score: 0.691
Data Source: STRINGDB
P2RX3
Tchem
Family: IC
Novelty: 0.00216381
Score: 0.678
Data Source: STRINGDB
LIN7B
Tbio
Novelty: 0.19240914
Score: 0.612
Data Source: STRINGDB
P2RX5
Tchem
Family: IC
Novelty: 0.02646451
Score: 0.602
Data Source: STRINGDB
Publication Statistics
PubMed Score  215.78

PubMed score by year
PubTator Score  84.35

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MKPTSGPEEARRPASDIRVFASNCSMHGLGHVFGPGSLSLRRGMWAAAVVLSVATFLYQVAERVRYYREF
1-70
HHQTALDERESHRLIFPAVTLCNINPLRRSRLTPNDLHWAGSALLGLDPAEHAAFLRALGRPPAPPGFMP
70-140
SPTFDMAQLYARAGHSLDDMLLDCRFRGQPCGPENFTTIFTRMGKCYTFNSGADGAELLTTTRGGMGNGL
140-210
DIMLDVQQEEYLPVWRDNEETPFEVGIRVQIHSQEEPPIIDQLGLGVSPGYQTFVSCQQQQLSFLPPPWG
210-280
DCSSASLNPNYEPEPSDPLGSPSPSPSPPYTLMGCRLACETRYVARKCGCRMVYMPGDVPVCSPQQYKNC
280-350
AHPAIDAMLRKDSCACPNPCASTRYAKELSMVRIPSRAAARFLARKLNRSEAYIAENVLALDIFFEALNY
350-420
ETVEQKKAYEMSELLGDIGGQMGLFIGASLLTILEILDYLCEVFRDKVLGYFWNRQHSQRHSSTNLLQEG
420-490
LGSHRTQVPHLSLGPRPPTPPCAVTKTLSASHRTCYLVTQL
490-531
MKPTSGPEEARRPASDIRVFASNCSMHGLGHVFGPGSLSLRRGMWAAAVVLSVATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRLTPNDLHWAGSALLGLDPAEHAAFLRALGRPPAPPGFMPSPTFDMAQLYARAGHSLDDMLLDCRFRGQPCGPENFTTIFTRMGKCYTFNSGADGAELLTTTRGGMGNGLDIMLDVQQEEYLPVWRDNEETPFEVGIRVQIHSQEEPPIIDQLGLGVSPGYQTFVSCQQQQLSFLPPPWGDCSSASLNPNYEPEPSDPLGSPSPSPSPPYTLMGCRLACETRYVARKCGCRMVYMPGDVPVCSPQQYKNCAHPAIDAMLRKDSCACPNPCASTRYAKELSMVRIPSRAAARFLARKLNRSEAYIAENVLALDIFFEALNYETVEQKKAYEMSELLGDIGGQMGLFIGASLLTILEILDYLCEVFRDKVLGYFWNRQHSQRHSSTNLLQEGLGSHRTQVPHLSLGPRPPTPPCAVTKTLSASHRTCYLVTQL