You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NDRG3
Protein NDRG3

Protein Classes
Protein Summary
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.97
transcription factor perturbation
0.94
tissue
0.71
histone modification site profile
0.69
disease perturbation
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 15.84   (req: < 5)
Gene RIFs: 13   (req: <= 3)
Antibodies: 125   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 15.84   (req: >= 5)
Gene RIFs: 13   (req: > 3)
Antibodies: 125   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (6)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Protein-Protein Interactions (27)
1 – 10 of 27
FXYD1
Tbio
Family: IC
Novelty: 0.00176593
p_int: 0.999998347
p_ni: 4.4e-7
p_wrong: 0.000001214
Score: 0.355
Data Source: BioPlex,STRINGDB
PICK1
Tbio
Novelty: 0.00686801
p_int: 0.999794895
p_ni: 0.000006366
p_wrong: 0.000198739
Score: 0.209
Data Source: BioPlex,STRINGDB
TUSC3
Tbio
Novelty: 0.01081706
p_int: 0.998855105
p_ni: 0.000006758
p_wrong: 0.001138137
Score: 0.239
Data Source: BioPlex,STRINGDB
PRSS21
Tbio
Family: Enzyme
Novelty: 0.00474208
p_int: 0.816980553
p_ni: 0.000054904
p_wrong: 0.182964544
Data Source: BioPlex
STK38L
Tchem
Family: Kinase
Novelty: 0.054716
Score: 0.908
Data Source: STRINGDB
TARDBP
Tbio
Novelty: 0.00206735
Score: 0.866
Data Source: STRINGDB
CSTF1
Tbio
Novelty: 0.11966948
Score: 0.84
Data Source: STRINGDB
NPEPL1
Tdark
Family: Enzyme
Novelty: 1.23076923
Score: 0.807
Data Source: STRINGDB
HDHD3
Tdark
Family: Enzyme
Novelty: 2.25
Score: 0.734
Data Source: STRINGDB
EDEM2
Tbio
Family: Enzyme
Novelty: 0.16891213
Score: 0.69
Data Source: STRINGDB
Publication Statistics
PubMed Score  15.84

PubMed score by year
PubTator Score  11.85

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDELQDVQLTEIKPLLNDKNGTRNFQDFDCQEHDIETTHGVVHVTIRGLPKGNRPVILTYHDIGLNHKSC
1-70
FNAFFNFEDMQEITQHFAVCHVDAPGQQEGAPSFPTGYQYPTMDELAEMLPPVLTHLSLKSIIGIGVGAG
70-140
AYILSRFALNHPELVEGLVLINVDPCAKGWIDWAASKLSGLTTNVVDIILAHHFGQEELQANLDLIQTYR
140-210
MHIAQDINQDNLQLFLNSYNGRRDLEIERPILGQNDNKSKTLKCSTLLVVGDNSPAVEAVVECNSRLNPI
210-280
NTTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPSASMTRLARSRTHSTSSSLGSGESPFSRSVTSN
280-350
QSDGTQESCESPDVLDRHQTMEVSC
350-375
MDELQDVQLTEIKPLLNDKNGTRNFQDFDCQEHDIETTHGVVHVTIRGLPKGNRPVILTYHDIGLNHKSCFNAFFNFEDMQEITQHFAVCHVDAPGQQEGAPSFPTGYQYPTMDELAEMLPPVLTHLSLKSIIGIGVGAGAYILSRFALNHPELVEGLVLINVDPCAKGWIDWAASKLSGLTTNVVDIILAHHFGQEELQANLDLIQTYRMHIAQDINQDNLQLFLNSYNGRRDLEIERPILGQNDNKSKTLKCSTLLVVGDNSPAVEAVVECNSRLNPINTTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPSASMTRLARSRTHSTSSSLGSGESPFSRSVTSNQSDGTQESCESPDVLDRHQTMEVSC