You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
POLK
DNA polymerase kappa

Protein Summary
Description
DNA polymerase specifically involved in DNA repair. Plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Depending on the context, it inserts the correct base, but causes frequent base transitions, transversions and frameshifts. Lacks 3'-5' proofreading exonuclease activity. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but does not have lyase activity. This gene encodes a member of the DNA polymerase type-Y family of proteins. The encoded protein is a specialized DNA polymerase that catalyzes translesion DNA synthesis, which allows DNA replication in the presence of DNA lesions. Human cell lines lacking a functional copy of this gene exhibit impaired genome integrity and enhanced susceptibility to oxidative damage. Mutations in this gene that impair enzyme activity may be associated with prostate cancer in human patients. [provided by RefSeq, Sep 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000241436
  • ENSP00000241436
  • ENSG00000122008
  • ENST00000504026
  • ENSP00000425075
  • ENST00000508526
  • ENSP00000426853
  • ENST00000509126
  • ENSP00000423532
  • ENST00000510815
  • ENSP00000422094
  • ENST00000515295
  • ENSP00000424174

Symbol
  • DINB1
  • DINP
  • POLQ
  • DINB1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.85
histone modification site profile
0.74
biological term
0.66
tissue sample
0.61
cell type or tissue
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 290.42   (req: < 5)
Gene RIFs: 66   (req: <= 3)
Antibodies: 296   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 290.42   (req: >= 5)
Gene RIFs: 66   (req: > 3)
Antibodies: 296   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (16)
1 – 5 of 16
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (44)
DNA Damage Bypass (R-HSA-73893)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 16
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
DNA Damage Bypass
Reactome
DNA Double-Strand Break Repair
Reactome
DNA Repair
Reactome
Dual Incision in GG-NER
Reactome
Dual incision in TC-NER
Name
Explore in Pharos
Explore in Source
DNA Damage Bypass
DNA Double-Strand Break Repair
DNA Repair
Dual Incision in GG-NER
Dual incision in TC-NER
Gene Ontology Terms (16)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (165)
1 – 10 of 165
KCTD17
Tbio
Novelty: 0.20322581
p_int: 0.999999884
p_ni: 9.8e-8
p_wrong: 1.8e-8
Score: 0.169
Data Source: BioPlex,STRINGDB
SPART
Tbio
Novelty: 0.01341821
p_int: 0.99999967
p_ni: 3.3e-7
Score: 0.282
Data Source: BioPlex,STRINGDB
PARVG
Tbio
Novelty: 0.14937655
p_int: 0.999616656
p_ni: 0.000198971
p_wrong: 0.000184373
Score: 0.559
Data Source: BioPlex,STRINGDB
DTD1
Tbio
Family: Enzyme
Novelty: 0.18316616
p_int: 0.94028146
p_ni: 0.000606267
p_wrong: 0.059112273
Score: 0.54
Data Source: BioPlex,STRINGDB
REV1
Tbio
Novelty: 0.00340661
Score: 0.998
Data Source: Reactome,STRINGDB
REV3L
Tbio
Family: Enzyme
Novelty: 0.00597116
Score: 0.983
Data Source: Reactome,STRINGDB
PCNA
Tchem
Novelty: 0.00995674
Score: 0.976
Data Source: Reactome,STRINGDB
LIG1
Tchem
Family: Enzyme
Novelty: 0.003789
Score: 0.973
Data Source: Reactome,STRINGDB
RAD51
Tchem
Novelty: 0.00014377
Score: 0.972
Data Source: STRINGDB
MAD2L2
Tbio
Novelty: 0.01600853
Score: 0.97
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  290.42

PubMed score by year
PubTator Score  166.92

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQ
1-70
KAQITSQQLRKAQLQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDNPELKDKPIAVGSMSMLSTSN
70-140
YHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKEVKEILADYDPNFMAMSLDEAYLNITKHLEE
140-210
RQNWPEDKRRYFIKMGSSVENDNPGKEVNKLSEHERSISPLLFEESPSDVQPPGDPFQVNFEEQNNPQIL
210-280
QNSVVFGTSAQEVVKEIRFRIEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLP
280-350
IRKVSGIGKVTEKMLKALGIITCTELYQQRALLSLLFSETSWHYFLHISLGLGSTHLTRDGERKSMSVER
350-420
TFSEINKAEEQYSLCQELCSELAQDLQKERLKGRTVTIKLKNVNFEVKTRASTVSSVVSTAEEIFAIAKE
420-490
LLKTEIDADFPHPLRLRLMGVRISSFPNEEDRKHQQRSIIGFLQAGNQALSATECTLEKTDKDKFVKPLE
490-560
MSHKKSFFDKKRSERKWSHQDTFKCEAVNKQSFQTSQPFQVLKKKMNENLEISENSDDCQILTCPVCFRA
560-630
QGCISLEALNKHVDECLDGPSISENFKMFSCSHVSATKVNKKENVPASSLCEKQDYEAHPKIKEISSVDC
630-700
IALVDTIDNSSKAESIDALSNKHSKEECSSLPSKSFNIEHCHQNSSSTVSLENEDVGSFRQEYRQPYLCE
700-770
VKTGQALVCPVCNVEQKTSDLTLFNVHVDVCLNKSFIQELRKDKFNPVNQPKESSRSTGSSSGVQKAVTR
770-840
TKRPGLMTKYSTSKKIKPNNPKHTLDIFFK
840-870
MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDNPELKDKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKEVKEILADYDPNFMAMSLDEAYLNITKHLEERQNWPEDKRRYFIKMGSSVENDNPGKEVNKLSEHERSISPLLFEESPSDVQPPGDPFQVNFEEQNNPQILQNSVVFGTSAQEVVKEIRFRIEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRKVSGIGKVTEKMLKALGIITCTELYQQRALLSLLFSETSWHYFLHISLGLGSTHLTRDGERKSMSVERTFSEINKAEEQYSLCQELCSELAQDLQKERLKGRTVTIKLKNVNFEVKTRASTVSSVVSTAEEIFAIAKELLKTEIDADFPHPLRLRLMGVRISSFPNEEDRKHQQRSIIGFLQAGNQALSATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQSFQTSQPFQVLKKKMNENLEISENSDDCQILTCPVCFRAQGCISLEALNKHVDECLDGPSISENFKMFSCSHVSATKVNKKENVPASSLCEKQDYEAHPKIKEISSVDCIALVDTIDNSSKAESIDALSNKHSKEECSSLPSKSFNIEHCHQNSSSTVSLENEDVGSFRQEYRQPYLCEVKTGQALVCPVCNVEQKTSDLTLFNVHVDVCLNKSFIQELRKDKFNPVNQPKESSRSTGSSSGVQKAVTRTKRPGLMTKYSTSKKIKPNNPKHTLDIFFK