You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
HDAC6
Histone deacetylase 6

Protein Summary
Description
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes (By similarity). Plays a central role in microtubule-dependent cell motility via deacetylation of tubulin. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer. In addition to its protein deacetylase activity, plays a key role in the degradation of misfolded proteins: when misfolded proteins are too abundant to be degraded by the chaperone refolding system and the ubiquitin-proteasome, mediates the transport of misfolded proteins to a cytoplasmic juxtanuclear structure called aggresome. Probably acts as an adapter that recognizes polyubiquitinated misfolded proteins and target them to the aggres ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000334136
  • ENSP00000334061
  • ENSG00000094631
  • ENST00000376619
  • ENSP00000365804
  • ENST00000426196
  • ENSP00000402189
  • ENST00000643374
  • ENSP00000496046
  • ENST00000644068
  • ENSP00000496013

Symbol
  • KIAA0901
  • HD6
  • JM21
  • CPBHM
  • PPP1R90
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
molecular function
1
histone modification site profile
0.9
interacting protein
0.89
hub protein
0.88


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 689.27   (req: < 5)
Gene RIFs: 214   (req: <= 3)
Antibodies: 978   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 689.27   (req: >= 5)
Gene RIFs: 214   (req: > 3)
Antibodies: 978   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 68
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 1525
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 4
Active Ligands (1525)
1 – 10 of 1525
CHEMBL99
chemical structure image
CHEMBL408513
chemical structure image
CHEMBL356066
chemical structure image
CHEMBL2018302,CHEMBL3770936
chemical structure image
CHEMBL1213490
chemical structure image
CHEMBL598797
chemical structure image
CHEMBL1213492
chemical structure image
CHEMBL1851943,CHEMBL3215861
chemical structure image
CHEMBL96051
chemical structure image
CHEMBL356769
chemical structure image
Protein Data Bank (17)
1 – 5 of 17
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (39)
Cellular response to heat stress (R-HSA-3371556)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 24
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cellular response to heat stress
Reactome
Cellular responses to external stimuli
Reactome
Cellular responses to stress
Reactome
Cilium Assembly
Reactome
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
Name
Explore in Pharos
Explore in Source
Cellular response to heat stress
Cellular responses to external stimuli
Cellular responses to stress
Cilium Assembly
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
Gene Ontology Terms (85)
Items per page:
10
1 – 10 of 19
GO Term
Evidence
Assigned by
Inferred from Experiment (EXP)
Reactome
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (356)
1 – 10 of 356
TUBA3C
Tchem
Novelty: 0.08740564
p_int: 0.99999557
p_ni: 0.00000443
Score: 0.174
Data Source: BioPlex,STRINGDB
NCOA1
Tchem
Family: Epigenetic
Novelty: 0.00427551
p_int: 0.999946969
p_ni: 0.000052888
p_wrong: 1.43e-7
Score: 0.21
Data Source: BioPlex,STRINGDB
LPIN3
Tbio
Family: Enzyme
Novelty: 0.02517952
p_int: 0.999903133
p_ni: 0.00009685
p_wrong: 1.7e-8
Score: 0.201
Data Source: BioPlex,STRINGDB
UBL7
Tdark
Novelty: 0.30057803
p_int: 0.999675342
p_ni: 0.000324148
p_wrong: 5.1e-7
Score: 0.613
Data Source: BioPlex,STRINGDB
TIMM50
Tbio
Family: Enzyme
Novelty: 0.03118503
p_int: 0.999500946
p_ni: 0.000499054
p_wrong: 1e-9
Score: 0.199
Data Source: BioPlex,STRINGDB
CHEK1
Tchem
Family: Kinase
Novelty: 0.00078041
p_int: 0.999452122
p_ni: 0.000547878
Score: 0.256
Data Source: BioPlex,STRINGDB
KCNAB3
Tbio
Family: IC
Novelty: 0.16424117
p_int: 0.999265822
p_ni: 0.000734176
p_wrong: 2e-9
Score: 0.267
Data Source: BioPlex,STRINGDB
NYAP2
Tdark
Family: Enzyme
Novelty: 1.35550122
p_int: 0.998392308
p_ni: 0.001606304
p_wrong: 0.000001388
Data Source: BioPlex
MCM7
Tbio
Novelty: 0.00227245
p_int: 0.998253088
p_ni: 0.001745688
p_wrong: 0.000001224
Score: 0.238
Data Source: BioPlex,STRINGDB
TULP2
Tdark
Family: TF
Novelty: 0.22688209
p_int: 0.998182874
p_ni: 0.001793295
p_wrong: 0.000023831
Score: 0.159
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  689.27

PubMed score by year
PubTator Score  517.11

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVG
1-70
LQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEE
70-140
LMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAII
140-210
RPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQ
210-280
GRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQG
280-350
DPKGEMAATPAGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSA
350-420
QASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQNMM
420-490
NHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCHSAEYVGHLRATEKMKTRELH
490-560
RESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLNGAAVVRPPGHHAEQDAACGFCFFNSVAVAA
560-630
RHAQTISGHALRILIVDWDVHHGNGTQHMFEDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFT
630-700
VNVAWNGPRMGDADYLAAWHRLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLA
700-770
SGRIILILEGGYNLTSISESMAACTRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVE
770-840
DREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSETAVVALTQDQP
840-910
SEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGAILDQTTSEDAVGGATLGQTT
910-980
SEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQTPLASSTDHQTPPTSPVQGTTPQISPSTLI
980-1050
GSLRTLELGSESQGASESQAPGEENLLGEAAGGQDMADSMLMQGSRGLTDQAIFYAVTPLPWCPHLVAVC
1050-1120
PIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYV
1120-1190
HHQALLDVKNIAHQNKFGEDMPHPH
1190-1215
MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATPAGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSAQASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQNMMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCHSAEYVGHLRATEKMKTRELHRESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLNGAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQTISGHALRILIVDWDVHHGNGTQHMFEDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGDADYLAAWHRLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILILEGGYNLTSISESMAACTRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVEDREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSETAVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGAILDQTTSEDAVGGATLGQTTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQTPLASSTDHQTPPTSPVQGTTPQISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEAAGGQDMADSMLMQGSRGLTDQAIFYAVTPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGEDMPHPH