You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
P2RX2
P2X purinoceptor 2

Protein Summary
Description
Ion channel gated by extracellular ATP involved in a variety of cellular responses, such as excitatory postsynaptic responses in sensory neurons, neuromuscular junctions (NMJ) formation, hearing, perception of taste and peristalsis. In the inner ear, regulates sound transduction and auditory neurotransmission, outer hair cell electromotility, inner ear gap junctions, and K(+) recycling. Mediates synaptic transmission between neurons and from neurons to smooth muscle. The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Aug 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000343948
  • ENSP00000343339
  • ENSG00000187848
  • ENST00000348800
  • ENSP00000345095
  • ENST00000350048
  • ENSP00000343904
  • ENST00000351222
  • ENSP00000344502
  • ENST00000352418
  • ENSP00000341419
  • ENST00000389110
  • ENSP00000373762
  • ENST00000449132
  • ENSP00000405531
  • ENST00000643471
  • ENSP00000494644

Symbol
  • P2X2
  • P2X2
  • DFNA41
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
1
cellular component
0.94
biological process
0.84
kinase perturbation
0.84
tissue
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 314.45   (req: < 5)
Gene RIFs: 28   (req: <= 3)
Antibodies: 311   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 314.45   (req: >= 5)
Gene RIFs: 28   (req: > 3)
Antibodies: 311   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 25
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 2
Active Ligands (1)
1 – 1 of 1
PSB-10211
chemical structure image
Pathways (7)
Elevation of cytosolic Ca2+ levels (R-HSA-139853)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Elevation of cytosolic Ca2+ levels
Reactome
Hemostasis
Reactome
Platelet calcium homeostasis
Reactome
Platelet homeostasis
Name
Explore in Pharos
Explore in Source
Elevation of cytosolic Ca2+ levels
Hemostasis
Platelet calcium homeostasis
Platelet homeostasis
Gene Ontology Terms (33)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
ProtInc
Non-traceable Author Statement (NAS)
BHF-UCL
Protein-Protein Interactions (84)
1 – 10 of 84
KIAA1586
Tdark
Novelty: 5
p_int: 0.999676872
p_ni: 0.000322982
p_wrong: 1.46e-7
Score: 0.187
Data Source: BioPlex,STRINGDB
EIF2AK3
Tchem
Family: Kinase
Novelty: 0.00059307
p_int: 0.99718514
p_ni: 0.00281486
Data Source: BioPlex
CANX
Tbio
Novelty: 0.00135361
p_int: 0.988062811
p_ni: 0.011937189
Data Source: BioPlex
C1QL1
Tdark
Novelty: 0.19017433
p_int: 0.982796139
p_ni: 0.016558375
p_wrong: 0.000645486
Data Source: BioPlex
EVI5L
Tbio
Novelty: 1.27659574
p_int: 0.982676106
p_ni: 0.01616645
p_wrong: 0.001157444
Data Source: BioPlex
D2HGDH
Tbio
Family: Enzyme
Novelty: 0.06483443
p_int: 0.975345623
p_ni: 0.011680333
p_wrong: 0.012974044
Data Source: BioPlex
STARD3
Tbio
Novelty: 0.02326413
p_int: 0.970308203
p_ni: 0.029691608
p_wrong: 1.89e-7
Data Source: BioPlex
GXYLT1
Tdark
Family: Enzyme
Novelty: 0.93745897
p_int: 0.965490806
p_ni: 0.033924994
p_wrong: 0.0005842
Score: 0.556
Data Source: BioPlex,STRINGDB
FKBP7
Tbio
Family: Enzyme
Novelty: 0.00592035
p_int: 0.958379469
p_ni: 0.041620142
p_wrong: 3.89e-7
Score: 0.173
Data Source: BioPlex,STRINGDB
HS2ST1
Tbio
Family: Enzyme
Novelty: 0.06029259
p_int: 0.943058629
p_ni: 0.056941371
Data Source: BioPlex
Publication Statistics
PubMed Score  314.45

PubMed score by year
PubTator Score  161.5

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MAAAQPKYPAGATARRLARGCWSALWDYETPKVIVVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQES
1-70
ETGPESSIITKVKGITTSEHKVWDVEEYVKPPEGGSVFSIITRVEATHSQTQGTCPESIRVHNATCLSDA
70-140
DCVAGELDMLGNGLRTGRCVPYYQGPSKTCEVFGWCPVEDGASVSQFLGTMAPNFTILIKNSIHYPKFHF
140-210
SKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEKAGESFTELAHKGGVIGVIINWDCDLDLPASECN
210-280
PKYSFRRLDPKHVPASSGYNFRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALT
280-350
SVGVGSFLCDWILLTFMNKNKVYSHKKFDKVCTPSHPSGSWPVTLARVLGQAPPEPGHRSEDQHPSPPSG
350-420
QEGQQGAECGPAFPPLRPCPISAPSEQMVDTPASEPAQASTPTDPKGLAQL
420-471
MAAAQPKYPAGATARRLARGCWSALWDYETPKVIVVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKGITTSEHKVWDVEEYVKPPEGGSVFSIITRVEATHSQTQGTCPESIRVHNATCLSDADCVAGELDMLGNGLRTGRCVPYYQGPSKTCEVFGWCPVEDGASVSQFLGTMAPNFTILIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEKAGESFTELAHKGGVIGVIINWDCDLDLPASECNPKYSFRRLDPKHVPASSGYNFRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSVGVGSFLCDWILLTFMNKNKVYSHKKFDKVCTPSHPSGSWPVTLARVLGQAPPEPGHRSEDQHPSPPSGQEGQQGAECGPAFPPLRPCPISAPSEQMVDTPASEPAQASTPTDPKGLAQL