Protein Classes
Protein Summary
Ion channel gated by extracellular ATP involved in a variety of cellular responses, such as excitatory postsynaptic responses in sensory neurons, neuromuscular junctions (NMJ) formation, hearing, perception of taste and peristalsis. In the inner ear, regulates sound transduction and auditory neurotransmission, outer hair cell electromotility, inner ear gap junctions, and K(+) recycling. Mediates synaptic transmission between neurons and from neurons to smooth muscle. The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Aug 2013]
- ENST00000343948
- ENSP00000343339
- ENSG00000187848
- ENST00000348800
- ENSP00000345095
- ENST00000350048
- ENSP00000343904
- ENST00000351222
- ENSP00000344502
- ENST00000352418
- ENSP00000341419
- ENST00000389110
- ENSP00000373762
- ENST00000449132
- ENSP00000405531
- ENST00000643471
- ENSP00000494644
- P2X2
- P2X2
- DFNA41
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
molecular function | 1 | ||
cellular component | 0.94 | ||
biological process | 0.84 | ||
kinase perturbation | 0.84 | ||
tissue | 0.68 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 314.45 (req: < 5)
Gene RIFs: 28 (req: <= 3)
Antibodies: 311 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 314.45 (req: >= 5)
Gene RIFs: 28 (req: > 3)
Antibodies: 311 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 25
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 1
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drugs: 2
Approved Drugs (2)
1 – 2 of 2
Active Ligands (1)
1 – 1 of 1
Pathways (7)
Reactome (4)
KEGG (3)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 4 of 4
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Elevation of cytosolic Ca2+ levels | ||||
Reactome | Hemostasis | ||||
Reactome | Platelet calcium homeostasis | ||||
Reactome | Platelet homeostasis | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Elevation of cytosolic Ca2+ levels | ||||
Hemostasis | ||||
Platelet calcium homeostasis | ||||
Platelet homeostasis | ||||
Gene Ontology Terms (33)
Functions (6)
Components (8)
Processes (19)
Items per page:
10
1 – 6 of 6
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Physical Interaction (IPI) | BHF-UCL | |||
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Traceable Author Statement (TAS) | ProtInc | |||
Non-traceable Author Statement (NAS) | BHF-UCL | |||
Protein-Protein Interactions (84)
1 – 10 of 84
KIAA1586
Novelty: 5
p_int: 0.999676872
p_ni: 0.000322982
p_wrong: 1.46e-7
Score: 0.187
Data Source: BioPlex,STRINGDB
EIF2AK3
Family: Kinase
Novelty: 0.00059307
p_int: 0.99718514
p_ni: 0.00281486
Data Source: BioPlex
CANX
Novelty: 0.00135361
p_int: 0.988062811
p_ni: 0.011937189
Data Source: BioPlex
C1QL1
Novelty: 0.19017433
p_int: 0.982796139
p_ni: 0.016558375
p_wrong: 0.000645486
Data Source: BioPlex
EVI5L
Novelty: 1.27659574
p_int: 0.982676106
p_ni: 0.01616645
p_wrong: 0.001157444
Data Source: BioPlex
D2HGDH
Family: Enzyme
Novelty: 0.06483443
p_int: 0.975345623
p_ni: 0.011680333
p_wrong: 0.012974044
Data Source: BioPlex
STARD3
Novelty: 0.02326413
p_int: 0.970308203
p_ni: 0.029691608
p_wrong: 1.89e-7
Data Source: BioPlex
GXYLT1
Family: Enzyme
Novelty: 0.93745897
p_int: 0.965490806
p_ni: 0.033924994
p_wrong: 0.0005842
Score: 0.556
Data Source: BioPlex,STRINGDB
FKBP7
Family: Enzyme
Novelty: 0.00592035
p_int: 0.958379469
p_ni: 0.041620142
p_wrong: 3.89e-7
Score: 0.173
Data Source: BioPlex,STRINGDB
HS2ST1
Family: Enzyme
Novelty: 0.06029259
p_int: 0.943058629
p_ni: 0.056941371
Data Source: BioPlex
Publication Statistics
PubMed Score 314.45
PubMed score by year
PubTator Score 161.5
PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MAAAQPKYPAGATARRLARGCWSALWDYETPKVIVVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQES
1-70
ETGPESSIITKVKGITTSEHKVWDVEEYVKPPEGGSVFSIITRVEATHSQTQGTCPESIRVHNATCLSDA
70-140
DCVAGELDMLGNGLRTGRCVPYYQGPSKTCEVFGWCPVEDGASVSQFLGTMAPNFTILIKNSIHYPKFHF
140-210
SKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEKAGESFTELAHKGGVIGVIINWDCDLDLPASECN
210-280
PKYSFRRLDPKHVPASSGYNFRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALT
280-350
SVGVGSFLCDWILLTFMNKNKVYSHKKFDKVCTPSHPSGSWPVTLARVLGQAPPEPGHRSEDQHPSPPSG
350-420
QEGQQGAECGPAFPPLRPCPISAPSEQMVDTPASEPAQASTPTDPKGLAQL
420-471
MAAAQPKYPAGATARRLARGCWSALWDYETPKVIVVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKGITTSEHKVWDVEEYVKPPEGGSVFSIITRVEATHSQTQGTCPESIRVHNATCLSDADCVAGELDMLGNGLRTGRCVPYYQGPSKTCEVFGWCPVEDGASVSQFLGTMAPNFTILIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEKAGESFTELAHKGGVIGVIINWDCDLDLPASECNPKYSFRRLDPKHVPASSGYNFRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSVGVGSFLCDWILLTFMNKNKVYSHKKFDKVCTPSHPSGSWPVTLARVLGQAPPEPGHRSEDQHPSPPSGQEGQQGAECGPAFPPLRPCPISAPSEQMVDTPASEPAQASTPTDPKGLAQL
Find similar targets by: