You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MTRR
Methionine synthase reductase

Protein Summary
Description
Involved in the reductive regeneration of cob(I)alamin (vitamin B12) cofactor required for the maintenance of methionine synthase in a functional state. Necessary for utilization of methylgroups from the folate cycle, thereby affecting transgenerational epigenetic inheritance. Folate pathway donates methyl groups necessary for cellular methylation and affects different pathways such as DNA methylation, possibly explaining the transgenerational epigenetic inheritance effects. This gene encodes a member of the ferredoxin-NADP(+) reductase (FNR) family of electron transferases. This protein functions in the synthesis of methionine by regenerating methionine synthase to a functional state. Because methionine synthesis requires methyl-group transfer by a folate donor, activity of the encoded enzyme is important for folate metabolism and cellular methylation. Mutations in this gene can cause homocystinuria-megaloblastic anemia, cbl E type. Alternative splicing of this gene results in multipl ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000264668
  • ENSP00000264668
  • ENSG00000124275
  • ENST00000440940
  • ENSP00000402510
  • ENST00000510279
  • ENSP00000427200
  • ENST00000514369
  • ENSP00000426132

Symbol
  • MSR
  • cblE
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.99
molecular function
0.97
pathway
0.88
biological term
0.84
histone modification site profile
0.78


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 381.74   (req: < 5)
Gene RIFs: 187   (req: <= 3)
Antibodies: 79   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 381.74   (req: >= 5)
Gene RIFs: 187   (req: > 3)
Antibodies: 79   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 20
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (19)
Biological oxidations (R-HSA-211859)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 15
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Biological oxidations
Reactome
Cobalamin (Cbl, vitamin B12) transport and metabolism
Reactome
Defective MTR causes methylmalonic aciduria and homocystinuria type cblG
Reactome
Defective MTRR causes methylmalonic aciduria and homocystinuria type cblE
Reactome
Defects in cobalamin (B12) metabolism
Name
Explore in Pharos
Explore in Source
Biological oxidations
Cobalamin (Cbl, vitamin B12) transport and metabolism
Defective MTR causes methylmalonic aciduria and homocystinuria type cblG
Defective MTRR causes methylmalonic aciduria and homocystinuria type cblE
Defects in cobalamin (B12) metabolism
Gene Ontology Terms (21)
Items per page:
10
1 – 10 of 10
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
CACAO
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
UniProtKB
Protein-Protein Interactions (80)
1 – 10 of 80
MTR
Tbio
Family: Enzyme
Novelty: 0.00105146
Score: 0.996
Data Source: Reactome,STRINGDB
MMACHC
Tbio
Novelty: 0.01333275
Score: 0.988
Data Source: STRINGDB
MMADHC
Tbio
Novelty: 0.03382644
Score: 0.987
Data Source: STRINGDB
SMS
Tchem
Family: Enzyme
Novelty: 0.03313893
Score: 0.962
Data Source: STRINGDB
MTHFR
Tbio
Family: Enzyme
Novelty: 0.00020963
Score: 0.94
Data Source: STRINGDB
MMAB
Tbio
Family: Enzyme
Novelty: 0.01573568
Score: 0.857
Data Source: STRINGDB
UBA6
Tchem
Novelty: 0.11710037
Score: 0.852
Data Source: STRINGDB
MMAA
Tbio
Novelty: 0.00536256
Score: 0.84
Data Source: STRINGDB
CBS
Tchem
Family: Enzyme
Novelty: 0.00051588
Score: 0.835
Data Source: STRINGDB
CBSL
Tdark
Novelty: 0.00051279
Score: 0.835
Data Source: STRINGDB
Publication Statistics
PubMed Score  381.74

PubMed score by year
PubTator Score  363.94

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGAASVRAGARLVEVALCSFTVTCLEVMRRFLLLYATQQGQAKAIAEEICEQAVVHGFSADLHCISESDK
1-70
YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGLLGLGDSEYTYFCNGGKIIDK
70-140
RLQELGARHFYDTGHADDCVGLELVVEPWIAGLWPALRKHFRSSRGQEEISGALPVASPASSRTDLVKSE
140-210
LLHIESQVELLRFDDSGRKDSEVLKQNAVNSNQSNVVIEDFESSLTRSVPPLSQASLNIPGLPPEYLQVH
210-280
LQESLGQEESQVSVTSADPVFQVPISKAVQLTTNDAIKTTLLVELDISNTDFSYQPGDAFSVICPNSDSE
280-350
VQSLLQRLQLEDKREHCVLLKIKADTKKKGATLPQHIPAGCSLQFIFTWCLEIRAIPKKAFLRALVDYTS
350-420
DSAEKRRLQELCSKQGAADYSRFVRDACACLLDLLLAFPSCQPPLSLLLEHLPKLQPRPYSCASSSLFHP
420-490
GKLHFVFNIVEFLSTATTEVLRKGVCTGWLALLVASVLQPNIHASHEDSGKALAPKISISPRTTNSFHLP
490-560
DDPSIPIIMVGPGTGIAPFIGFLQHREKLQEQHPDGNFGAMWLFFGCRHKDRDYLFRKELRHFLKHGILT
560-630
HLKVSFSRDAPVGEEEAPAKYVQDNIQLHGQQVARILLQENGHIYVCGDAKNMAKDVHDALVQIISKEVG
630-700
VEKLEAMKTLATLKEEKRYLQDIWS
700-725
MGAASVRAGARLVEVALCSFTVTCLEVMRRFLLLYATQQGQAKAIAEEICEQAVVHGFSADLHCISESDKYDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGLLGLGDSEYTYFCNGGKIIDKRLQELGARHFYDTGHADDCVGLELVVEPWIAGLWPALRKHFRSSRGQEEISGALPVASPASSRTDLVKSELLHIESQVELLRFDDSGRKDSEVLKQNAVNSNQSNVVIEDFESSLTRSVPPLSQASLNIPGLPPEYLQVHLQESLGQEESQVSVTSADPVFQVPISKAVQLTTNDAIKTTLLVELDISNTDFSYQPGDAFSVICPNSDSEVQSLLQRLQLEDKREHCVLLKIKADTKKKGATLPQHIPAGCSLQFIFTWCLEIRAIPKKAFLRALVDYTSDSAEKRRLQELCSKQGAADYSRFVRDACACLLDLLLAFPSCQPPLSLLLEHLPKLQPRPYSCASSSLFHPGKLHFVFNIVEFLSTATTEVLRKGVCTGWLALLVASVLQPNIHASHEDSGKALAPKISISPRTTNSFHLPDDPSIPIIMVGPGTGIAPFIGFLQHREKLQEQHPDGNFGAMWLFFGCRHKDRDYLFRKELRHFLKHGILTHLKVSFSRDAPVGEEEAPAKYVQDNIQLHGQQVARILLQENGHIYVCGDAKNMAKDVHDALVQIISKEVGVEKLEAMKTLATLKEEKRYLQDIWS