You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
EPS15L1
Epidermal growth factor receptor substrate 15-like 1

Protein Summary
Description
Seems to be a constitutive component of clathrin-coated pits that is required for receptor-mediated endocytosis. Involved in endocytosis of integrin beta-1 (ITGB1) and transferrin receptor (TFR); internalization of ITGB1 as DAB2-dependent cargo but not TFR seems to require association with DAB2.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000248070
  • ENSP00000248070
  • ENSG00000127527
  • ENST00000455140
  • ENSP00000393313
  • ENST00000535753
  • ENSP00000440103
  • ENST00000597937
  • ENSP00000472267
  • ENST00000602022
  • ENSP00000471981

Symbol
  • EPS15R
  • EPS15R
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
drug perturbation
0.96
kinase perturbation
0.95
interacting protein
0.91
phenotype
0.85
ligand (protein) perturbation
0.83


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 11.45   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 187   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 11.45   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 187   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (11)
Cargo recognition for clathrin-mediated endocytosis (R-HSA-8856825)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cargo recognition for clathrin-mediated endocytosis
Reactome
Clathrin-mediated endocytosis
Reactome
EGFR downregulation
Reactome
Membrane Trafficking
Reactome
Signal Transduction
Name
Explore in Pharos
Explore in Source
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
EGFR downregulation
Membrane Trafficking
Signal Transduction
Gene Ontology Terms (10)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
BHF-UCL
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (191)
1 – 10 of 191
ITSN2
Tbio
Novelty: 0.01558254
p_int: 0.999999999
p_ni: 1e-9
Score: 0.978
Data Source: BioPlex,STRINGDB
FCHO2
Tbio
Novelty: 0.21241004
p_int: 0.999999995
p_ni: 5e-9
Score: 0.979
Data Source: BioPlex,STRINGDB
ITSN1
Tbio
Novelty: 0.01483242
p_int: 0.999999941
p_ni: 5.9e-8
Score: 0.978
Data Source: BioPlex,STRINGDB
STON2
Tbio
Novelty: 0.03435283
p_int: 0.999999865
p_ni: 1.35e-7
Score: 0.983
Data Source: BioPlex,STRINGDB
EPS15
Tbio
Novelty: 0.00518368
p_int: 0.999999787
p_ni: 2.13e-7
Score: 0.931
Data Source: BioPlex,STRINGDB
AP1B1
Tbio
Novelty: 0.03313791
p_int: 0.999996027
p_ni: 0.000003973
Score: 0.655
Data Source: BioPlex,STRINGDB
SPC25
Tbio
Novelty: 0.48
p_int: 0.999991926
p_ni: 0.000008074
Score: 0.221
Data Source: BioPlex,STRINGDB
AP2A2
Tbio
Novelty: 0.19247594
p_int: 0.999988719
p_ni: 0.000011282
Score: 0.965
Data Source: BioPlex,STRINGDB
AP2M1
Tbio
Novelty: 0.01240983
p_int: 0.99994985
p_ni: 0.00005015
Score: 0.968
Data Source: BioPlex,STRINGDB
SYCE1
Tbio
Novelty: 0.07934297
p_int: 0.999948913
p_ni: 0.000051087
Data Source: BioPlex
Publication Statistics
PubMed Score  11.45

PubMed score by year
PubTator Score  11.83

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAPLIPLSQQIPTGNSLYESYYKQVDPAYTGRVGASEAALFLKKSGLSDIILGKIWDLADPEGKGFLDK
1-70
QGFYVALRLVACAQSGHEVTLSNLNLSMPPPKFHDTSSPLMVTPPSAEAHWAVRVEEKAKFDGIFESLLP
70-140
INGLLSGDKVKPVLMNSKLPLDVLGRVWDLSDIDKDGHLDRDEFAVAMHLVYRALEKEPVPSALPPSLIP
140-210
PSKRKKTVFPGAVPVLPASPPPKDSLRSTPSHGSVSSLNSTGSLSPKHSLKQTQPTVNWVVPVADKMRFD
210-280
EIFLKTDLDLDGYVSGQEVKEIFMHSGLTQNLLAHIWALADTRQTGKLSKDQFALAMYFIQQKVSKGIDP
280-350
PQVLSPDMVPPSERGTPGPDSSGSLGSGEFTGVKELDDISQEIAQLQREKYSLEQDIREKEEAIRQKTSE
350-420
VQELQNDLDRETSSLQELEAQKQDAQDRLDEMDQQKAKLRDMLSDVRQKCQDETQMISSLKTQIQSQESD
420-490
LKSQEDDLNRAKSELNRLQQEETQLEQSIQAGRVQLETIIKSLKSTQDEINQARSKLSQLHESRQEAHRS
490-560
LEQYDQVLDGAHGASLTDLANLSEGVSLAERGSFGAMDDPFKNKALLFSNNTQELHPDPFQTEDPFKSDP
560-630
FKGADPFKGDPFQNDPFAEQQTTSTDPFGGDPFKESDPFRGSATDDFFKKQTKNDPFTSDPFTKNPSLPS
630-700
KLDPFESSDPFSSSSVSSKGSDPFGTLDPFGSGSFNSAEGFADFSQMSKPPPSGPFTSSLGGAGFSDDPF
700-770
KSKQDTPALPPKKPAPPRPKPPSGKSTPVSQLGSADFPEAPDPFQPLGADSGDPFQSKKGFGDPFSGKDP
770-840
FVPSSAAKPSKASASGFADFTSVS
840-864
MAAPLIPLSQQIPTGNSLYESYYKQVDPAYTGRVGASEAALFLKKSGLSDIILGKIWDLADPEGKGFLDKQGFYVALRLVACAQSGHEVTLSNLNLSMPPPKFHDTSSPLMVTPPSAEAHWAVRVEEKAKFDGIFESLLPINGLLSGDKVKPVLMNSKLPLDVLGRVWDLSDIDKDGHLDRDEFAVAMHLVYRALEKEPVPSALPPSLIPPSKRKKTVFPGAVPVLPASPPPKDSLRSTPSHGSVSSLNSTGSLSPKHSLKQTQPTVNWVVPVADKMRFDEIFLKTDLDLDGYVSGQEVKEIFMHSGLTQNLLAHIWALADTRQTGKLSKDQFALAMYFIQQKVSKGIDPPQVLSPDMVPPSERGTPGPDSSGSLGSGEFTGVKELDDISQEIAQLQREKYSLEQDIREKEEAIRQKTSEVQELQNDLDRETSSLQELEAQKQDAQDRLDEMDQQKAKLRDMLSDVRQKCQDETQMISSLKTQIQSQESDLKSQEDDLNRAKSELNRLQQEETQLEQSIQAGRVQLETIIKSLKSTQDEINQARSKLSQLHESRQEAHRSLEQYDQVLDGAHGASLTDLANLSEGVSLAERGSFGAMDDPFKNKALLFSNNTQELHPDPFQTEDPFKSDPFKGADPFKGDPFQNDPFAEQQTTSTDPFGGDPFKESDPFRGSATDDFFKKQTKNDPFTSDPFTKNPSLPSKLDPFESSDPFSSSSVSSKGSDPFGTLDPFGSGSFNSAEGFADFSQMSKPPPSGPFTSSLGGAGFSDDPFKSKQDTPALPPKKPAPPRPKPPSGKSTPVSQLGSADFPEAPDPFQPLGADSGDPFQSKKGFGDPFSGKDPFVPSSAAKPSKASASGFADFTSVS