You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GNG13
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13

Protein Summary
Description
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Heterotrimeric G proteins, which consist of alpha (see MIM 139320), beta (see MIM 139380), and gamma subunits, function as signal transducers for the 7-transmembrane-helix G protein-coupled receptors. GNG13 is a gamma subunit that is expressed in taste, retinal, and neuronal tissues and plays a key role in taste transduction (Li et al., 2006 [PubMed 16473877]).[supplied by OMIM, Oct 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000248150
  • ENSP00000248150
  • ENSG00000127588

Symbol
  • h2-35
  • G(gamma)13
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
pathway
0.68
kinase perturbation
0.66
PubMedID
0.59
cell type or tissue
0.56
transcription factor
0.48


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.41   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 49   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.41   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 49   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (85)
ADP signalling through P2Y purinoceptor 1 (R-HSA-418592)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 54
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
ADP signalling through P2Y purinoceptor 1
Reactome
ADP signalling through P2Y purinoceptor 12
Reactome
Activation of kainate receptors upon glutamate binding
Reactome
Adrenaline,noradrenaline inhibits insulin secretion
Reactome
Aquaporin-mediated transport
Name
Explore in Pharos
Explore in Source
ADP signalling through P2Y purinoceptor 1
ADP signalling through P2Y purinoceptor 12
Activation of kainate receptors upon glutamate binding
Adrenaline,noradrenaline inhibits insulin secretion
Aquaporin-mediated transport
Gene Ontology Terms (7)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (938)
1 – 10 of 938
GNB3
Tbio
Novelty: 0.0043523
Score: 0.999
Data Source: Reactome,STRINGDB
GNB1
Tbio
Novelty: 0.04716243
Score: 0.999
Data Source: STRINGDB
GNB4
Tbio
Novelty: 0.1530232
Score: 0.999
Data Source: STRINGDB
GNAT3
Tbio
Novelty: 0.004945
Score: 0.974
Data Source: Reactome,STRINGDB
GNG3
Tbio
Novelty: 0.16248863
Score: 0.971
Data Source: STRINGDB
GNAO1
Tbio
Novelty: 0.0056926
Score: 0.97
Data Source: STRINGDB
GNB2
Tbio
Novelty: 0.20536996
Score: 0.966
Data Source: STRINGDB
GNB5
Tbio
Novelty: 0.01077999
Score: 0.962
Data Source: STRINGDB
GNG12
Tbio
Novelty: 0.19029707
Score: 0.962
Data Source: STRINGDB
GNAI1
Tbio
Novelty: 0.12575547
Score: 0.961
Data Source: STRINGDB
Publication Statistics
PubMed Score  6.41

PubMed score by year
PubTator Score  5.13

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL
1-70
MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL