You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
VAPA
Vesicle-associated membrane protein-associated protein A

Protein Summary
Description
Binds to OSBPL3, which mediates recruitment of VAPA to plasma membrane sites (PubMed:25447204). The ORP3-VAPA complex stimulates RRAS signaling which in turn attenuates integrin beta-1 (ITGB1) activation at the cell surface (PubMed:25447204). With OSBPL3, may regulate ER morphology (PubMed:16143324). May play a role in vesicle trafficking (PubMed:11511104, PubMed:19289470). The protein encoded by this gene is a type IV membrane protein. It is present in the plasma membrane and intracellular vesicles. It may also be associated with the cytoskeleton. This protein may function in vesicle trafficking, membrane fusion, protein complex assembly and cell motility. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000340541
  • ENSP00000345656
  • ENSG00000101558
  • ENST00000400000
  • ENSP00000382880

Symbol
  • VAP33
  • VAP-A
  • VAP33
  • VAP-33
  • hVAP-33
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
1
kinase perturbation
1
disease perturbation
0.99
virus perturbation
0.98
transcription factor binding site profile
0.87


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 434.29   (req: < 5)
Gene RIFs: 21   (req: <= 3)
Antibodies: 248   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 434.29   (req: >= 5)
Gene RIFs: 21   (req: > 3)
Antibodies: 248   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 17
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (17)
Competing endogenous RNAs (ceRNAs) regulate PTEN translation (R-HSA-8948700)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 15
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Competing endogenous RNAs (ceRNAs) regulate PTEN translation
Reactome
Immune System
Reactome
Innate Immune System
Reactome
Insertion of tail-anchored proteins into the endoplasmic reticulum membrane
Reactome
Intracellular signaling by second messengers
Name
Explore in Pharos
Explore in Source
Competing endogenous RNAs (ceRNAs) regulate PTEN translation
Immune System
Innate Immune System
Insertion of tail-anchored proteins into the endoplasmic reticulum membrane
Intracellular signaling by second messengers
Protein-Protein Interactions (288)
1 – 10 of 288
OSBPL2
Tbio
Novelty: 0.04469551
p_int: 1
Score: 0.813
Data Source: BioPlex,STRINGDB
VAPB
Tbio
Novelty: 0.00566042
p_int: 0.999999999
p_ni: 1e-9
Score: 0.956
Data Source: BioPlex,STRINGDB
PITPNM1
Tbio
Novelty: 0.01016609
p_int: 0.999999984
p_ni: 1.2e-8
p_wrong: 4e-9
Score: 0.842
Data Source: BioPlex,STRINGDB
ACBD5
Tbio
Novelty: 0.14084507
p_int: 0.999999981
p_ni: 1.8e-8
p_wrong: 1e-9
Score: 0.754
Data Source: BioPlex,STRINGDB
NACAD
Tbio
Novelty: 0.12765957
p_int: 0.999999797
p_ni: 1.85e-7
p_wrong: 1.8e-8
Score: 0.441
Data Source: BioPlex,STRINGDB
ZFPL1
Tbio
Novelty: 0.06292606
p_int: 0.999999789
p_ni: 2.11e-7
Score: 0.196
Data Source: BioPlex,STRINGDB
ARHGEF12
Tbio
Novelty: 0.00213883
p_int: 0.999999734
p_ni: 2.66e-7
Score: 0.16
Data Source: BioPlex,STRINGDB
OSBPL9
Tbio
Novelty: 0.17213189
p_int: 0.999999715
p_ni: 2.83e-7
p_wrong: 2e-9
Score: 0.827
Data Source: BioPlex,STRINGDB
RASSF1
Tbio
Novelty: 0.00155893
p_int: 0.999999631
p_ni: 3.36e-7
p_wrong: 3.2e-8
Score: 0.252
Data Source: BioPlex,STRINGDB
OSBP2
Tbio
Novelty: 0.0038273
p_int: 0.999999606
p_ni: 4.6e-8
p_wrong: 3.49e-7
Score: 0.921
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  434.29

PubMed score by year
PubTator Score  72.29

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDP
1-70
GSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLN
70-140
DMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSD
140-210
KPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL
210-249
MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL