You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
KCND2
Potassium voltage-gated channel subfamily D member 2

Protein Summary
Description
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain. Mediates the major part of the dendritic A-type current I(SA) in brain neurons (By similarity). This current is activated at membrane potentials that are below the threshold for action potentials. It regulates neuronal excitability, prolongs the latency before the first spike in a series of action potentials, regulates the frequency of repetitive action potential firing, shortens the duration of action potentials and regulates the back-propagation of action potentials from the neuronal cell body to the dendrites. Contributes to the regulation of the circadian rhythm of action potential firing in suprachiasmatic nucleus neurons, which regulates the circadian rhythm of locomotor activity (By similarity). Functions downstream of the metabotropic glutamate receptor GRM5 and plays a role in neuronal excitability and in nociception mediated by activation of GRM5 (By ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000331113
  • ENSP00000333496
  • ENSG00000184408

Symbol
  • KIAA1044
  • RK5
  • KV4.2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
1
molecular function
0.93
kinase
0.72
PubMedID
0.67
cell line
0.63


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 260.09   (req: < 5)
Gene RIFs: 38   (req: <= 3)
Antibodies: 386   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 260.09   (req: >= 5)
Gene RIFs: 38   (req: > 3)
Antibodies: 386   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 4
Active Ligands (1)
1 – 1 of 1
CHEMBL15594
chemical structure image
Pathways (18)
Cardiac conduction (R-HSA-5576891)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cardiac conduction
Reactome
Muscle contraction
Reactome
Neuronal System
Reactome
Phase 1 - inactivation of fast Na+ channels
Reactome
Potassium Channels
Name
Explore in Pharos
Explore in Source
Cardiac conduction
Muscle contraction
Neuronal System
Phase 1 - inactivation of fast Na+ channels
Potassium Channels
Gene Ontology Terms (29)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (223)
1 – 10 of 223
KCTD17
Tbio
Novelty: 0.20322581
p_int: 0.998560269
p_ni: 0.001439677
p_wrong: 5.4e-8
Score: 0.692
Data Source: BioPlex,STRINGDB
HSPA8
Tchem
Novelty: 0.00100906
p_int: 0.98821575
p_ni: 0.01178425
Score: 0.168
Data Source: BioPlex,STRINGDB
BAG1
Tbio
Novelty: 0.0033615
p_int: 0.974112209
p_ni: 0.025887731
p_wrong: 6e-8
Score: 0.173
Data Source: BioPlex,STRINGDB
KCTD2
Tdark
Novelty: 0.48979592
p_int: 0.945428872
p_ni: 0.000566424
p_wrong: 0.054004704
Score: 0.582
Data Source: BioPlex,STRINGDB
BAG3
Tbio
Novelty: 0.00469463
p_int: 0.862575688
p_ni: 0.137424312
Score: 0.151
Data Source: BioPlex,STRINGDB
GNB4
Tbio
Novelty: 0.1530232
p_int: 0.85135665
p_ni: 0.148643131
p_wrong: 2.18e-7
Score: 0.187
Data Source: BioPlex,STRINGDB
KCTD5
Tbio
Novelty: 0.01880316
p_int: 0.798166348
p_ni: 0.20183353
p_wrong: 1.22e-7
Score: 0.871
Data Source: BioPlex,STRINGDB
STUB1
Tbio
Family: Enzyme
Novelty: 0.00091876
p_int: 0.781907182
p_ni: 0.218092818
Score: 0.206
Data Source: BioPlex,STRINGDB
KCNIP2
Tbio
Family: IC
Novelty: 0.0124069
Score: 0.997
Data Source: Reactome,STRINGDB
KCNIP1
Tbio
Family: IC
Novelty: 0.02615849
Score: 0.997
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  260.09

PubMed score by year
PubTator Score  124.26

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLERYPDTLLGSS
1-70
ERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELAFFGLIPEIIGDCCYEEYKDR
70-140
RRENAERLQDDADTDTAGESALPTMTARQRVWRAFENPHTSTMALVFYYVTGFFIAVSVIANVVETVPCG
140-210
SSPGHIKELPCGERYAVAFFCLDTACVMIFTVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMT
210-280
DNEDVSGAFVTLRVFRVFRIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSS
280-350
ASKFTSIPAAFWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD
350-420
KRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHLLHCLEKTTN
420-490
HEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHQGSIQELSTIQ
490-560
IRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL
560-630
MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLERYPDTLLGSSERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELAFFGLIPEIIGDCCYEEYKDRRRENAERLQDDADTDTAGESALPTMTARQRVWRAFENPHTSTMALVFYYVTGFFIAVSVIANVVETVPCGSSPGHIKELPCGERYAVAFFCLDTACVMIFTVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFRIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPAAFWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL