You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GPRC5B
G-protein coupled receptor family C group 5 member B

Protein Summary
Description
Unknown. This retinoic acid-inducible G-protein coupled receptor provide evidence for a possible interaction between retinoid and G-protein signaling pathways. This gene encodes a member of the type 3 G protein-coupled receptor family. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. The encoded protein may modulate insulin secretion and increased protein expression is associated with type 2 diabetes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000300571
  • ENSP00000300571
  • ENSG00000167191
  • ENST00000535671
  • ENSP00000442858
  • ENST00000569479
  • ENSP00000454727
  • ENST00000569847
  • ENSP00000457283

Symbol
  • RAIG2
  • RAIG2
  • RAIG-2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.85
biological process
0.81
gene perturbation
0.81
histone modification site profile
0.77
molecular function
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 17.85   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 289   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 17.85   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 289   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (1)
Items per page:
1 – 1 of 1
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
GPCRs, Class C Metabotropic glutamate, pheromone
Name
Explore in Pharos
Explore in Source
GPCRs, Class C Metabotropic glutamate, pheromone
Protein-Protein Interactions (76)
1 – 10 of 76
TNFRSF1A
Tchem
Novelty: 0.00048442
p_int: 0.999820247
p_ni: 0.000179018
p_wrong: 7.36e-7
Data Source: BioPlex
CD70
Tbio
Novelty: 0.00552433
p_int: 0.999482005
p_ni: 0.000517091
p_wrong: 9.03e-7
Data Source: BioPlex
TMEM171
Tdark
Novelty: 5.91917098
p_int: 0.999138203
p_ni: 0.000860406
p_wrong: 0.000001391
Data Source: BioPlex
MPP7
Tbio
Novelty: 1.2173913
p_int: 0.99903419
p_ni: 0.000965231
p_wrong: 5.78e-7
Score: 0.187
Data Source: BioPlex,STRINGDB
IPPK
Tbio
Family: Enzyme
Novelty: 0.04063664
p_int: 0.99520172
p_ni: 0.003200318
p_wrong: 0.001597962
Data Source: BioPlex
C11orf87
Tdark
p_int: 0.99458701
p_ni: 0.005287963
p_wrong: 0.000125028
Data Source: BioPlex
CHRND
Tclin
Family: IC
Novelty: 0.04863852
p_int: 0.987854732
p_ni: 0.003947601
p_wrong: 0.008197667
Data Source: BioPlex
ADGRE5
Tbio
Family: GPCR
Novelty: 0.01324684
p_int: 0.986110481
p_ni: 0.013381726
p_wrong: 0.000507794
Score: 0.577
Data Source: BioPlex,STRINGDB
CSGALNACT1
Tbio
Family: Enzyme
Novelty: 0.03092432
p_int: 0.982668795
p_ni: 0.016767006
p_wrong: 0.000564199
Score: 0.21
Data Source: BioPlex,STRINGDB
LPAR1
Tchem
Family: GPCR
Novelty: 0.004102
p_int: 0.978373387
p_ni: 0.001671987
p_wrong: 0.019954625
Score: 0.272
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  17.85

PubMed score by year
PubTator Score  10.5

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MFVASERKMRAHQVLTFLLLFVITSVASENASTSRGCGLDLLPQYVSLCDLDAIWGIVVEAVAGAGALIT
1-70
LLLMLILLVRLPFIKEKEKKSPVGLHFLFLLGTLGLFGLTFAFIIQEDETICSVRRFLWGVLFALCFSCL
70-140
LSQAWRVRRLVRHGTGPAGWQLVGLALCLMLVQVIIAVEWLVLTVLRDTRPACAYEPMDFVMALIYDMVL
140-210
LVVTLGLALFTLCGKFKRWKLNGAFLLITAFLSVLIWVAWMTMYLFGNVKLQQGDAWNDPTLAITLAASG
210-280
WVFVIFHAIPEIHCTLLPALQENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGF
280-350
PNGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAPPSHTGRHLW
350-403
MFVASERKMRAHQVLTFLLLFVITSVASENASTSRGCGLDLLPQYVSLCDLDAIWGIVVEAVAGAGALITLLLMLILLVRLPFIKEKEKKSPVGLHFLFLLGTLGLFGLTFAFIIQEDETICSVRRFLWGVLFALCFSCLLSQAWRVRRLVRHGTGPAGWQLVGLALCLMLVQVIIAVEWLVLTVLRDTRPACAYEPMDFVMALIYDMVLLVVTLGLALFTLCGKFKRWKLNGAFLLITAFLSVLIWVAWMTMYLFGNVKLQQGDAWNDPTLAITLAASGWVFVIFHAIPEIHCTLLPALQENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAPPSHTGRHLW