You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PLA2G3
Group 3 secretory phospholipase A2

Protein Summary
Description
PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Shows an 11-fold preference for phosphatidylglycerol over phosphatidylcholine (PC). Preferential cleavage: 1-palmitoyl-2-linoleoyl-phosphatidylethanolamine (PE) > 1-palmitoyl-2-linoleoyl-PC > 1-palmitoyl-2-arachidonoyl-PC > 1-palmitoyl-2-arachidonoyl-PE. Plays a role in ciliogenesis. This gene encodes a protein that belongs to the secreted phospholipase A2 family, whose members include the bee venom enzyme. The encoded enzyme functions in lipid metabolism and catalyzes the calcium-dependent hydrolysis of the sn-2 acyl bond of phospholipids to release arachidonic acid and lysophospholipids. This enzyme acts as a negative regulator of ciliogenesis, and may play a role in cancer development by stimulating tumor cell growth and angiogenesis. This gene is associated with oxidative stress, and polymorphisms in this gene are linked to risk for Alzheimer's disease. [provided by RefSeq, Apr 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000215885
  • ENSP00000215885
  • ENSG00000100078

Symbol
  • SPLA2III
  • sPLA2-III
  • GIII-SPLA2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
metabolite
0.95
biological process
0.79
small molecule perturbation
0.65
microRNA
0.59
phenotype
0.57


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9.26   (req: < 5)
Gene RIFs: 18   (req: <= 3)
Antibodies: 166   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9.26   (req: >= 5)
Gene RIFs: 18   (req: > 3)
Antibodies: 166   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (30)
Acyl chain remodelling of PC (R-HSA-1482788)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Acyl chain remodelling of PC
Reactome
Acyl chain remodelling of PE
Reactome
Acyl chain remodelling of PG
Reactome
Glycerophospholipid biosynthesis
Reactome
Metabolism
Name
Explore in Pharos
Explore in Source
Acyl chain remodelling of PC
Acyl chain remodelling of PE
Acyl chain remodelling of PG
Glycerophospholipid biosynthesis
Metabolism
Gene Ontology Terms (21)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Protein-Protein Interactions (79)
1 – 10 of 79
PCSK1N
Tbio
Novelty: 0.0045381
p_int: 0.977451911
p_ni: 0.002980932
p_wrong: 0.019567157
Data Source: BioPlex
HSPA5
Tchem
Novelty: 0.00051387
p_int: 0.840549243
p_ni: 0.159450757
Data Source: BioPlex
ACTA2
Tbio
Novelty: 0.00281551
p_int: 0.788873292
p_ni: 0.211126708
Data Source: BioPlex
PLA2G2D
Tchem
Family: Enzyme
Novelty: 0.00127599
Score: 0.9
Data Source: STRINGDB
PLA2G15
Tbio
Family: Enzyme
Novelty: 0.01771583
Score: 0.897
Data Source: STRINGDB
PLA2G12A
Tbio
Family: Enzyme
Novelty: 0.03340096
Score: 0.807
Data Source: STRINGDB
PLA2G10
Tchem
Family: Enzyme
Novelty: 0.00367717
Score: 0.805
Data Source: STRINGDB
PLA2G7
Tchem
Family: Enzyme
Novelty: 0.00370934
Score: 0.789
Data Source: STRINGDB
PTGS2
Tclin
Family: Enzyme
Novelty: 0.00008134
Score: 0.774
Data Source: STRINGDB
PLD3
Tbio
Family: Enzyme
Novelty: 0.01450885
Score: 0.763
Data Source: STRINGDB
Publication Statistics
PubMed Score  9.26

PubMed score by year
PubTator Score  10.69

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGVQAGLFGMLGFLGVALGGSPALRWYRTSCHLTKAVPGNPLGYLSFLAKDAQGLALIHARWDAHRRLQS
1-70
CSWEDEPELTAAYGALCAHETAWGSFIHTPGPELQRALATLQSQWEACRALEESPAGARKKRAAGQSGVP
70-140
GGGHQREKRGWTMPGTLWCGVGDSAGNSSELGVFQGPDLCCREHDRCPQNISPLQYNYGIRNYRFHTISH
140-210
CDCDTRFQQCLQNQHDSISDIVGVAFFNVLEIPCFVLEEQEACVAWYWWGGCRMYGTVPLARLQPRTFYN
210-280
ASWSSRATSPTPSSRSPAPPKPRQKQHLRKGPPHQKGSKRPSKANTTALQDPMVSPRLDVAPTGLQGPQG
280-350
GLKPQGARWVCRSFRRHLDQCEHQIGPREIEFQLLNSAQEPLFHCNCTRRLARFLRLHSPPEVTNMLWEL
350-420
LGTTCFKLAPPLDCVEGKNCSRDPRAIRVSARHLRRLQQRRHQLQDKGTDERQPWPSEPLRGPMSFYNQC
420-490
LQLTQAARRPDRQQKSWSQ
490-509
MGVQAGLFGMLGFLGVALGGSPALRWYRTSCHLTKAVPGNPLGYLSFLAKDAQGLALIHARWDAHRRLQSCSWEDEPELTAAYGALCAHETAWGSFIHTPGPELQRALATLQSQWEACRALEESPAGARKKRAAGQSGVPGGGHQREKRGWTMPGTLWCGVGDSAGNSSELGVFQGPDLCCREHDRCPQNISPLQYNYGIRNYRFHTISHCDCDTRFQQCLQNQHDSISDIVGVAFFNVLEIPCFVLEEQEACVAWYWWGGCRMYGTVPLARLQPRTFYNASWSSRATSPTPSSRSPAPPKPRQKQHLRKGPPHQKGSKRPSKANTTALQDPMVSPRLDVAPTGLQGPQGGLKPQGARWVCRSFRRHLDQCEHQIGPREIEFQLLNSAQEPLFHCNCTRRLARFLRLHSPPEVTNMLWELLGTTCFKLAPPLDCVEGKNCSRDPRAIRVSARHLRRLQQRRHQLQDKGTDERQPWPSEPLRGPMSFYNQCLQLTQAARRPDRQQKSWSQ