You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TAS2R4
Taste receptor type 2 member 4

Protein Summary
Description
Gustducin-coupled receptor for denatonium and N(6)-propyl-2-thiouracil implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5. In airway epithelial cells, binding of denatonium increases the intracellular calcium ion concentration and stimulates ciliary beat frequency. This gene encodes a member of a family of candidate taste receptors that are members of the G protein-coupled receptor superfamily and that are specifically expressed by taste receptor cells of the tongue and palate epithelia. These apparently intronless genes encode a 7-transmembrane receptor protein, functioning as a bitter taste receptor. This gene is clustered with another 3 candidate taste receptor genes in chromosome 7 and is genetically linked to loci that influence bitter perception. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000247881
  • ENSP00000247881
  • ENSG00000127364

Symbol
  • T2R4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.96
tissue
0.6
tissue sample
0.53
cell line
0.51
metabolite
0.45


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 24.31   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 31   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 24.31   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 31   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Class C/3 (Metabotropic glutamate/pheromone receptors) (R-HSA-420499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class C/3 (Metabotropic glutamate/pheromone receptors)
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Signal Transduction
Name
Explore in Pharos
Explore in Source
Class C/3 (Metabotropic glutamate/pheromone receptors)
G alpha (i) signalling events
GPCR downstream signalling
GPCR ligand binding
Signal Transduction
Protein-Protein Interactions (249)
1 – 10 of 249
GNAT3
Tbio
Novelty: 0.004945
Score: 0.979
Data Source: STRINGDB
TAS1R2
Tbio
Family: GPCR
Novelty: 0.00853435
Score: 0.968
Data Source: STRINGDB
TAS1R1
Tbio
Family: GPCR
Novelty: 0.0152692
Score: 0.965
Data Source: STRINGDB
SSTR3
Tclin
Family: GPCR
Novelty: 0.00379402
Score: 0.964
Data Source: STRINGDB
TAS1R3
Tbio
Family: GPCR
Novelty: 0.0050744
Score: 0.958
Data Source: STRINGDB
MCHR2
Tchem
Family: GPCR
Novelty: 0.01078171
Score: 0.955
Data Source: STRINGDB
CASR
Tclin
Family: GPCR
Novelty: 0.00066875
Score: 0.939
Data Source: STRINGDB
SSTR5
Tclin
Family: GPCR
Novelty: 0.00312149
Score: 0.936
Data Source: STRINGDB
SSTR2
Tclin
Family: GPCR
Novelty: 0.00183799
Score: 0.936
Data Source: STRINGDB
GRM4
Tchem
Family: GPCR
Novelty: 0.00432322
Score: 0.933
Data Source: STRINGDB
Publication Statistics
PubMed Score  24.31

PubMed score by year
PubTator Score  15.64

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MLRLFYFSAIIASVILNFVGIIMNLFITVVNCKTWVKSHRISSSDRILFSLGITRFLMLGLFLVNTIYFV
1-70
SSNTERSVYLSAFFVLCFMFLDSSSVWFVTLLNILYCVKITNFQHSVFLLLKRNISPKIPRLLLACVLIS
70-140
AFTTCLYITLSQASPFPELVTTRNNTSFNISEGILSLVVSLVLSSSLQFIINVTSASLLIHSLRRHIQKM
140-210
QKNATGFWNPQTEAHVGAMKLMVYFLILYIPYSVATLVQYLPFYAGMDMGTKSICLIFATLYSPGHSVLI
210-280
IITHPKLKTTAKKILCFKK
280-299
MLRLFYFSAIIASVILNFVGIIMNLFITVVNCKTWVKSHRISSSDRILFSLGITRFLMLGLFLVNTIYFVSSNTERSVYLSAFFVLCFMFLDSSSVWFVTLLNILYCVKITNFQHSVFLLLKRNISPKIPRLLLACVLISAFTTCLYITLSQASPFPELVTTRNNTSFNISEGILSLVVSLVLSSSLQFIINVTSASLLIHSLRRHIQKMQKNATGFWNPQTEAHVGAMKLMVYFLILYIPYSVATLVQYLPFYAGMDMGTKSICLIFATLYSPGHSVLIIITHPKLKTTAKKILCFKK