You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TAS2R7
Taste receptor type 2 member 7

Protein Summary
Description
Gustducin-coupled receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5. This gene product belongs to the family of candidate taste receptors that are members of the G-protein-coupled receptor superfamily. These proteins are specifically expressed in the taste receptor cells of the tongue and palate epithelia. They are organized in the genome in clusters and are genetically linked to loci that influence bitter perception in mice and humans. In functional expression studies, they respond to bitter tastants. This gene maps to the taste receptor gene cluster on chromosome 12p13. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000240687
  • ENSP00000240687
  • ENSG00000121377
  • ENST00000574656
  • ENSP00000458498
  • ENSG00000273326
  • ENST00000613239
  • ENSP00000484743
  • ENSG00000274327

Symbol
  • T2R7
  • TRB4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell line
0.53
cell type or tissue
0.53
metabolite
0.45
protein domain
0.41
tissue
0.4


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.26   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 120   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.26   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 120   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Class C/3 (Metabotropic glutamate/pheromone receptors) (R-HSA-420499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class C/3 (Metabotropic glutamate/pheromone receptors)
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Signal Transduction
Name
Explore in Pharos
Explore in Source
Class C/3 (Metabotropic glutamate/pheromone receptors)
G alpha (i) signalling events
GPCR downstream signalling
GPCR ligand binding
Signal Transduction
Protein-Protein Interactions (251)
1 – 10 of 251
MVB12A
Tbio
Novelty: 0.01270321
p_int: 0.998501429
p_ni: 0.001498565
p_wrong: 5e-9
Score: 0.207
Data Source: BioPlex,STRINGDB
MICAL1
Tbio
Family: Enzyme
Novelty: 0.01559445
p_int: 0.996173199
p_ni: 0.003798204
p_wrong: 0.000028597
Score: 0.224
Data Source: BioPlex,STRINGDB
CCNYL1
Tdark
Novelty: 0.8
p_int: 0.995636276
p_ni: 0.004359735
p_wrong: 0.000003989
Data Source: BioPlex
INTS12
Tbio
Family: Epigenetic
Novelty: 0.13805881
p_int: 0.970163694
p_ni: 0.029834473
p_wrong: 0.000001834
Score: 0.181
Data Source: BioPlex,STRINGDB
BIRC2
Tchem
Novelty: 0.00265344
p_int: 0.95568877
p_ni: 0.044311209
p_wrong: 2.1e-8
Data Source: BioPlex
CD2AP
Tbio
Novelty: 0.00036564
p_int: 0.921709058
p_ni: 0.078290942
Score: 0.207
Data Source: BioPlex,STRINGDB
PRKCA
Tchem
Family: Kinase
Novelty: 0.00099987
p_int: 0.913081811
p_ni: 0.086918185
p_wrong: 3e-9
Score: 0.173
Data Source: BioPlex,STRINGDB
ATP2B4
Tbio
Family: Transporter
Novelty: 0.00694066
p_int: 0.895591786
p_ni: 0.104408204
p_wrong: 1e-8
Data Source: BioPlex
ACTBL2
Tbio
Novelty: 0.35273907
p_int: 0.841278354
p_ni: 0.158721646
Data Source: BioPlex
GNAQ
Tbio
Novelty: 0.00176666
p_int: 0.801767908
p_ni: 0.198228374
p_wrong: 0.000003718
Data Source: BioPlex
Publication Statistics
PubMed Score  6.26

PubMed score by year
PubTator Score  4.38

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MADKVQTTLLFLAVGEFSVGILGNAFIGLVNCMDWVKKRKIASIDLILTSLAISRICLLCVILLDCFILV
1-70
LYPDVYATGKEMRIIDFFWTLTNHLSIWFATCLSIYYFFKIGNFFHPLFLWMKWRIDRVISWILLGCVVL
70-140
SVFISLPATENLNADFRFCVKAKRKTNLTWSCRVNKTQHASTKLFLNLATLLPFCVCLMSFFLLILSLRR
140-210
HIRRMQLSATGCRDPSTEAHVRALKAVISFLLLFIAYYLSFLIATSSYFMPETELAVIFGESIALIYPSS
210-280
HSFILILGNNKLRHASLKVIWKVMSILKGRKFQQHKQI
280-318
MADKVQTTLLFLAVGEFSVGILGNAFIGLVNCMDWVKKRKIASIDLILTSLAISRICLLCVILLDCFILVLYPDVYATGKEMRIIDFFWTLTNHLSIWFATCLSIYYFFKIGNFFHPLFLWMKWRIDRVISWILLGCVVLSVFISLPATENLNADFRFCVKAKRKTNLTWSCRVNKTQHASTKLFLNLATLLPFCVCLMSFFLLILSLRRHIRRMQLSATGCRDPSTEAHVRALKAVISFLLLFIAYYLSFLIATSSYFMPETELAVIFGESIALIYPSSHSFILILGNNKLRHASLKVIWKVMSILKGRKFQQHKQI