You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
TAS2R8
Taste receptor type 2 member 8

Protein Summary
Description
Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5. This gene product belongs to the family of candidate taste receptors that are members of the G-protein-coupled receptor superfamily. These proteins are specifically expressed in the taste receptor cells of the tongue and palate epithelia. They are organized in the genome in clusters and are genetically linked to loci that influence bitter perception in mice and humans. In functional expression studies, they respond to bitter tastants. This gene maps to the taste receptor gene cluster on chromosome 12p13. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000240615
  • ENSP00000240615
  • ENSG00000121314
  • ENST00000572823
  • ENSP00000461158
  • ENSG00000272712
  • ENST00000610444
  • ENSP00000484163
  • ENSG00000277316

Symbol
  • T2R8
  • TRB5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue sample
0.79
cell line
0.55
tissue
0.47
cell type or tissue
0.41
pathway
0.38


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.2   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 36   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.2   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 36   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 67
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Class C/3 (Metabotropic glutamate/pheromone receptors) (R-HSA-420499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class C/3 (Metabotropic glutamate/pheromone receptors)
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Signal Transduction
Name
Explore in Pharos
Explore in Source
Class C/3 (Metabotropic glutamate/pheromone receptors)
G alpha (i) signalling events
GPCR downstream signalling
GPCR ligand binding
Signal Transduction
Protein-Protein Interactions (232)
1 – 10 of 232
SERPINB8
Tbio
Novelty: 0.00412031
p_int: 0.778101106
p_ni: 0.22116975
p_wrong: 0.000729144
Score: 0.39
Data Source: BioPlex,STRINGDB
GNAT3
Tbio
Novelty: 0.004945
Score: 0.974
Data Source: STRINGDB
TAS1R3
Tbio
Family: GPCR
Novelty: 0.0050744
Score: 0.954
Data Source: STRINGDB
TAS1R1
Tbio
Family: GPCR
Novelty: 0.0152692
Score: 0.939
Data Source: STRINGDB
MCHR2
Tchem
Family: GPCR
Novelty: 0.01078171
Score: 0.937
Data Source: STRINGDB
TAS1R2
Tbio
Family: GPCR
Novelty: 0.00853435
Score: 0.934
Data Source: STRINGDB
TAS2R16
Tbio
Family: GPCR
Novelty: 0.03546057
Score: 0.92
Data Source: STRINGDB
SSTR3
Tclin
Family: GPCR
Novelty: 0.00379402
Score: 0.916
Data Source: STRINGDB
TAS2R5
Tbio
Family: GPCR
Novelty: 0.13852935
Score: 0.915
Data Source: STRINGDB
TAS2R60
Tdark
Family: GPCR
Novelty: 0.97297297
Score: 0.914
Data Source: STRINGDB
Publication Statistics
PubMed Score  3.20

PubMed score by year
PubTator Score  3.35

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MFSPADNIFIILITGEFILGILGNGYIALVNWIDWIKKKKISTVDYILTNLVIARICLISVMVVNGIVIV
1-70
LNPDVYTKNKQQIVIFTFWTFANYLNMWITTCLNVFYFLKIASSSHPLFLWLKWKIDMVVHWILLGCFAI
70-140
SLLVSLIAAIVLSCDYRFHAIAKHKRNITEMFHVSKIPYFEPLTLFNLFAIVPFIVSLISFFLLVRSLWR
140-210
HTKQIKLYATGSRDPSTEVHVRAIKTMTSFIFFFFLYYISSILMTFSYLMTKYKLAVEFGEIAAILYPLG
210-280
HSLILIVLNNKLRQTFVRMLTCRKIACMI
280-309
MFSPADNIFIILITGEFILGILGNGYIALVNWIDWIKKKKISTVDYILTNLVIARICLISVMVVNGIVIVLNPDVYTKNKQQIVIFTFWTFANYLNMWITTCLNVFYFLKIASSSHPLFLWLKWKIDMVVHWILLGCFAISLLVSLIAAIVLSCDYRFHAIAKHKRNITEMFHVSKIPYFEPLTLFNLFAIVPFIVSLISFFLLVRSLWRHTKQIKLYATGSRDPSTEVHVRAIKTMTSFIFFFFLYYISSILMTFSYLMTKYKLAVEFGEIAAILYPLGHSLILIVLNNKLRQTFVRMLTCRKIACMI