You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
TAS2R9
Taste receptor type 2 member 9

Protein Summary
Description
Gustducin-coupled receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5 (By similarity). This gene product belongs to the family of candidate taste receptors that are members of the G-protein-coupled receptor superfamily. These proteins are specifically expressed in the taste receptor cells of the tongue and palate epithelia. They are organized in the genome in clusters and are genetically linked to loci that influence bitter perception in mice and humans. In functional expression studies, they respond to bitter tastants. This gene maps to the taste receptor gene cluster on chromosome 12p13. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000240691
  • ENSP00000240691
  • ENSG00000121381
  • ENST00000573524
  • ENSP00000460247
  • ENSG00000273086
  • ENST00000616297
  • ENSP00000480069
  • ENSG00000273713

Symbol
  • T2R9
  • TRB6
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue sample
0.59
cell type or tissue
0.58
cell line
0.52
tissue
0.51
metabolite
0.45


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.02   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 94   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.02   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 94   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Class C/3 (Metabotropic glutamate/pheromone receptors) (R-HSA-420499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class C/3 (Metabotropic glutamate/pheromone receptors)
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Signal Transduction
Name
Explore in Pharos
Explore in Source
Class C/3 (Metabotropic glutamate/pheromone receptors)
G alpha (i) signalling events
GPCR downstream signalling
GPCR ligand binding
Signal Transduction
Protein-Protein Interactions (231)
1 – 10 of 231
GNAT3
Tbio
Novelty: 0.004945
Score: 0.975
Data Source: STRINGDB
TAS1R3
Tbio
Family: GPCR
Novelty: 0.0050744
Score: 0.967
Data Source: STRINGDB
TAS1R2
Tbio
Family: GPCR
Novelty: 0.00853435
Score: 0.964
Data Source: STRINGDB
TAS1R1
Tbio
Family: GPCR
Novelty: 0.0152692
Score: 0.958
Data Source: STRINGDB
LPAR5
Tchem
Family: GPCR
Novelty: 0.02957489
Score: 0.932
Data Source: STRINGDB
MCHR2
Tchem
Family: GPCR
Novelty: 0.01078171
Score: 0.926
Data Source: STRINGDB
TAS2R4
Tbio
Family: GPCR
Novelty: 0.04115092
Score: 0.923
Data Source: STRINGDB
TAS2R16
Tbio
Family: GPCR
Novelty: 0.03546057
Score: 0.922
Data Source: STRINGDB
TAS2R38
Tbio
Family: GPCR
Novelty: 0.00547147
Score: 0.921
Data Source: STRINGDB
CASR
Tclin
Family: GPCR
Novelty: 0.00066875
Score: 0.919
Data Source: STRINGDB
Publication Statistics
PubMed Score  2.02

PubMed score by year
PubTator Score  2.69

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MPSAIEAIYIILIAGELTIGIWGNGFIVLVNCIDWLKRRDISLIDIILISLAISRICLLCVISLDGFFML
1-70
LFPGTYGNSVLVSIVNVVWTFANNSSLWFTSCLSIFYLLKIANISHPFFFWLKLKINKVMLAILLGSFLI
70-140
SLIISVPKNDDMWYHLFKVSHEENITWKFKVSKIPGTFKQLTLNLGVMVPFILCLISFFLLLFSLVRHTK
140-210
QIRLHATGFRDPSTEAHMRAIKAVIIFLLLLIVYYPVFLVMTSSALIPQGKLVLMIGDIVTVIFPSSHSF
210-280
ILIMGNSKLREAFLKMLRFVKCFLRRRKPFVP
280-312
MPSAIEAIYIILIAGELTIGIWGNGFIVLVNCIDWLKRRDISLIDIILISLAISRICLLCVISLDGFFMLLFPGTYGNSVLVSIVNVVWTFANNSSLWFTSCLSIFYLLKIANISHPFFFWLKLKINKVMLAILLGSFLISLIISVPKNDDMWYHLFKVSHEENITWKFKVSKIPGTFKQLTLNLGVMVPFILCLISFFLLLFSLVRHTKQIRLHATGFRDPSTEAHMRAIKAVIIFLLLLIVYYPVFLVMTSSALIPQGKLVLMIGDIVTVIFPSSHSFILIMGNSKLREAFLKMLRFVKCFLRRRKPFVP