You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
MAP3K20
Mitogen-activated protein kinase kinase kinase 20

Protein Summary
Description
Stress-activated component of a protein kinase signal transduction cascade. Regulates the JNK and p38 pathways. Part of a signaling cascade that begins with the activation of the adrenergic receptor ADRA1B and leads to the activation of MAPK14. Pro-apoptotic. Role in regulation of S and G2 cell cycle checkpoint by direct phosphorylation of CHEK2 (PubMed:10924358, PubMed:11836244, PubMed:15342622, PubMed:21224381). Involved in limb development (PubMed:26755636). Isoform 1: Phosphorylates histone H3 at 'Ser-28' (PubMed:15684425). May have role in neoplastic cell transformation and cancer development (PubMed:15172994). Causes cell shrinkage and disruption of actin stress fibers (PubMed:11042189). This gene is a member of the MAPKKK family of signal transduction molecules and encodes a protein with an N-terminal kinase catalytic domain, followed by a leucine zipper motif and a sterile-alpha motif (SAM). This magnesium-binding protein forms homodimers and is located in the cytoplasm. The pr ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000338983
  • ENSP00000340257
  • ENSG00000091436
  • ENST00000375213
  • ENSP00000364361
  • ENST00000409176
  • ENSP00000387259
  • ENST00000539448
  • ENSP00000439414

Symbol
  • MLTK
  • ZAK
  • pk
  • AZK
  • MLT
  • MRK
  • ZAK
  • CNM6
  • MLK7
  • MLTK
  • SFMMP
  • mlklak
  • MLTKbeta
  • MLTKalpha
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.74   (req: < 5)
Gene RIFs: 19   (req: <= 3)
Antibodies: 270   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.74   (req: >= 5)
Gene RIFs: 19   (req: > 3)
Antibodies: 270   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 20
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 3
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 2
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Protein-Protein Interactions (20)
1 – 10 of 20
ZNF544
Tdark
Family: TF
Novelty: 2
p_int: 0.999999953
p_ni: 4.7e-8
Score: 0.642
Data Source: BioPlex,STRINGDB
ZNF227
Tdark
Family: TF
Novelty: 2
p_int: 0.999998116
p_ni: 0.000001883
Score: 0.513
Data Source: BioPlex,STRINGDB
ZNF71
Tdark
Family: TF
Novelty: 0.25641026
p_int: 0.884231373
p_ni: 0.010571824
p_wrong: 0.105196804
Score: 0.234
Data Source: BioPlex,STRINGDB
PKN1
Tchem
Family: Kinase
Novelty: 0.00885136
Score: 0.951
Data Source: STRINGDB
MAP2K6
Tchem
Family: Kinase
Novelty: 0.00880457
Score: 0.947
Data Source: STRINGDB
MAP2K7
Tchem
Family: Kinase
Novelty: 0.0002234
Score: 0.897
Data Source: STRINGDB
ZNF33A
Tdark
Family: TF
Novelty: 0.28659366
Score: 0.823
Data Source: STRINGDB
ZNF567
Tdark
Family: TF
Novelty: 15
Score: 0.703
Data Source: STRINGDB
MAP2K4
Tchem
Family: Kinase
Novelty: 0.00352612
Score: 0.595
Data Source: STRINGDB
SLC25A20
Tbio
Family: Transporter
Novelty: 0.00531784
Score: 0.531
Data Source: STRINGDB
Publication Statistics
PubMed Score  18.74

PubMed score by year
PubTator Score  229.94

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYG
1-70
VILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVV
70-140
IAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLE
140-210
GLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNK
210-280
AEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQSNTPLLPSFEIGAWTEDDVYCWVQQ
280-350
LVRKGDSSAEMSVYASLFKENNITGKRLLLLEEEDLKDMGIVSKGHIIHFKSAIEKLTHDYINLFHFPPL
350-420
IKDSGGEPEENEEKIVNLELVFGFHLKPGTGPQDCKWKMYMEMDGDEIAITYIKDVTFNTNLPDAEILKM
420-490
TKPPFVMEKWIVGIAKSQTVECTVTYESDVRTPKSTKHVHSIQWSRTKPQDEVKAVQLAIQTLFTNSDGN
490-560
PGSRSDSSADCQWLDTLRMRQIASNTSLQRSQSNPILGSPFFSHFDGQDSYAAAVRRPQVPIKYQQITPV
560-630
NQSRSSSPTQYGLTKNFSSLHLNSRDSGFSSGNTDTSSERGRYSDRSRNKYGRGSISLNSSPRGRYSGKS
630-700
QHSTPSRGRYPGKFYRVSQSALNPHQSPDFKRSPRDLHQPNTIPGMPLHPETDSRASEEDSKVSEGGWTK
700-770
VEYRKKPHRPSPAKTNKERARGDHRGWRNF
770-800
MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQSNTPLLPSFEIGAWTEDDVYCWVQQLVRKGDSSAEMSVYASLFKENNITGKRLLLLEEEDLKDMGIVSKGHIIHFKSAIEKLTHDYINLFHFPPLIKDSGGEPEENEEKIVNLELVFGFHLKPGTGPQDCKWKMYMEMDGDEIAITYIKDVTFNTNLPDAEILKMTKPPFVMEKWIVGIAKSQTVECTVTYESDVRTPKSTKHVHSIQWSRTKPQDEVKAVQLAIQTLFTNSDGNPGSRSDSSADCQWLDTLRMRQIASNTSLQRSQSNPILGSPFFSHFDGQDSYAAAVRRPQVPIKYQQITPVNQSRSSSPTQYGLTKNFSSLHLNSRDSGFSSGNTDTSSERGRYSDRSRNKYGRGSISLNSSPRGRYSGKSQHSTPSRGRYPGKFYRVSQSALNPHQSPDFKRSPRDLHQPNTIPGMPLHPETDSRASEEDSKVSEGGWTKVEYRKKPHRPSPAKTNKERARGDHRGWRNF