You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
KCNK4
Potassium channel subfamily K member 4

Protein Summary
Description
Voltage-insensitive potassium channel (PubMed:22282805). Channel opening is triggered by mechanical forces that deform the membrane (PubMed:22282805, PubMed:25471887, PubMed:25500157). Channel opening is triggered by raising the intracellular pH to basic levels (By similarity). The channel is inactive at 24 degrees Celsius (in vitro); raising the temperature to 37 degrees Celsius increases the frequency of channel opening, with a further increase in channel activity when the temperature is raised to 42 degrees Celsius (By similarity). Plays a role in the perception of pain caused by heat (By similarity). Plays a role in the sensory perception of pain caused by pressure (By similarity). This gene encodes a member of the TWIK-related arachidonic acid-stimulated two pore potassium channel subfamily. The encoded protein homodimerizes and functions as an outwardly rectifying channel. This channel is regulated by polyunsaturated fatty acids, temperature and mechanical deformation of the lipi ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000394525
  • ENSP00000378033
  • ENSG00000182450
  • ENST00000422670
  • ENSP00000402797
  • ENST00000539216
  • ENSP00000444948

Symbol
  • TRAAK
  • TRAAK
  • K2p4.1
  • TRAAK1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.88
PubMedID
0.6
biological process
0.59
chemical
0.45
protein domain
0.41


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 44.5   (req: < 5)
Gene RIFs: 11   (req: <= 3)
Antibodies: 120   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 44.5   (req: >= 5)
Gene RIFs: 11   (req: > 3)
Antibodies: 120   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 17
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (8)
1 – 5 of 8
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (7)
Cardiac conduction (R-HSA-5576891)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cardiac conduction
Reactome
Muscle contraction
Reactome
Neuronal System
Reactome
Phase 4 - resting membrane potential
Reactome
Potassium Channels
Name
Explore in Pharos
Explore in Source
Cardiac conduction
Muscle contraction
Neuronal System
Phase 4 - resting membrane potential
Potassium Channels
Gene Ontology Terms (20)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (32)
1 – 10 of 32
KCNH3
Tclin
Family: IC
Novelty: 0.08510555
Score: 0.801
Data Source: STRINGDB
KCNQ3
Tclin
Family: IC
Novelty: 0.00715172
Score: 0.753
Data Source: STRINGDB
PIEZO1
Tchem
Family: IC
Novelty: 0.00589781
Score: 0.686
Data Source: STRINGDB
TRPM8
Tclin
Family: IC
Novelty: 0.00200706
Score: 0.634
Data Source: STRINGDB
TRPA1
Tclin
Family: IC
Novelty: 0.00104738
Score: 0.627
Data Source: STRINGDB
TRPV1
Tclin
Family: IC
Novelty: 0.00052256
Score: 0.595
Data Source: STRINGDB
PIEZO2
Tbio
Family: IC
Novelty: 0.00432783
Score: 0.564
Data Source: STRINGDB
KCNH4
Tclin
Family: IC
Novelty: 0.03855451
Score: 0.562
Data Source: STRINGDB
KCNA1
Tclin
Family: IC
Novelty: 0.00237321
Score: 0.561
Data Source: STRINGDB
KCNH8
Tclin
Family: IC
Novelty: 0.17485263
Score: 0.556
Data Source: STRINGDB
Publication Statistics
PubMed Score  44.50

PubMed score by year
PubTator Score  27.73

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALG
1-70
GGADPETNSTSNSSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGD
70-140
RLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTL
140-210
TTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVVSRRTRAEMGGLTAQAASWTG
210-280
TVTARVTQRAGPAAPPPEKEQPLLPPPPCPAQPLGRPRSPSPPEKAQPPSPPTASALDYPSENLAFIDES
280-350
SDTQSERGCPLPRAPRGRRRPNPPRKPVRPRGPGRPRDKGVPV
350-393
MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETNSTSNSSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVVSRRTRAEMGGLTAQAASWTGTVTARVTQRAGPAAPPPEKEQPLLPPPPCPAQPLGRPRSPSPPEKAQPPSPPTASALDYPSENLAFIDESSDTQSERGCPLPRAPRGRRRPNPPRKPVRPRGPGRPRDKGVPV