You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SLC39A1
Zinc transporter ZIP1

Protein Summary
Description
Mediates zinc uptake. May function as a major endogenous zinc uptake transporter in many cells of the body. Responsible for the rapid uptake and accumulation of physiologically effective zinc in prostate cells. This gene encodes a member of the zinc-iron permease family. The encoded protein is localized to the cell membrane and acts as a zinc uptake transporter. This gene has been linked to prostate cancer, breast cancer, and Alzheimer's disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000310483
  • ENSP00000309710
  • ENSG00000143570
  • ENST00000356205
  • ENSP00000348535
  • ENST00000368621
  • ENSP00000357610
  • ENST00000368623
  • ENSP00000357612
  • ENST00000617697
  • ENSP00000479421
  • ENST00000621013
  • ENSP00000484182

Symbol
  • IRT1
  • ZIP1
  • ZIRTL
  • ZIP1
  • ZIRTL
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.74
transcription factor binding site profile
0.74
tissue sample
0.71
histone modification site profile
0.68
cell type or tissue
0.67


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 91.46   (req: < 5)
Gene RIFs: 22   (req: <= 3)
Antibodies: 89   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 91.46   (req: >= 5)
Gene RIFs: 22   (req: > 3)
Antibodies: 89   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (10)
Metal ion SLC transporters (R-HSA-425410)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metal ion SLC transporters
Reactome
SLC-mediated transmembrane transport
Reactome
Transport of bile salts and organic acids, metal ions and amine compounds
Reactome
Transport of small molecules
Reactome
Zinc influx into cells by the SLC39 gene family
Name
Explore in Pharos
Explore in Source
Metal ion SLC transporters
SLC-mediated transmembrane transport
Transport of bile salts and organic acids, metal ions and amine compounds
Transport of small molecules
Zinc influx into cells by the SLC39 gene family
Protein-Protein Interactions (102)
1 – 10 of 102
TNFRSF1A
Tchem
Novelty: 0.00048442
p_int: 0.995463427
p_ni: 0.00453378
p_wrong: 0.000002793
Data Source: BioPlex
SCARA3
Tbio
Novelty: 0.00826861
p_int: 0.985643445
p_ni: 0.014356487
p_wrong: 6.9e-8
Data Source: BioPlex
P2RY12
Tclin
Family: GPCR
Novelty: 0.00057146
p_int: 0.983554759
p_ni: 0.016445193
p_wrong: 4.8e-8
Data Source: BioPlex
SPPL2B
Tbio
Family: Enzyme
Novelty: 0.03749833
p_int: 0.981419351
p_ni: 0.018580575
p_wrong: 7.4e-8
Score: 0.231
Data Source: BioPlex,STRINGDB
ADGRG5
Tdark
Family: GPCR
Novelty: 0.38877844
p_int: 0.980189571
p_ni: 0.019810191
p_wrong: 2.39e-7
Data Source: BioPlex
SLC7A1
Tbio
Family: Transporter
Novelty: 0.00093544
p_int: 0.979902106
p_ni: 0.020097862
p_wrong: 3.2e-8
Score: 0.195
Data Source: BioPlex,STRINGDB
NME2P1
Tdark
Family: Kinase
p_int: 0.978860189
p_ni: 0.021139806
p_wrong: 5e-9
Data Source: BioPlex
CLEC2D
Tbio
Novelty: 0.03470529
p_int: 0.976995305
p_ni: 0.023004583
p_wrong: 1.12e-7
Data Source: BioPlex
VIPR2
Tchem
Family: GPCR
Novelty: 0.00602252
p_int: 0.975045118
p_ni: 0.024954882
Data Source: BioPlex
FZD10
Tbio
Family: GPCR
Novelty: 0.03473251
p_int: 0.974700007
p_ni: 0.025299796
p_wrong: 1.97e-7
Data Source: BioPlex
Publication Statistics
PubMed Score  91.46

PubMed score by year
PubTator Score  59.61

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGPWGEPELLVWRPEAVASEPPVPVGLEVKLGALVLLLVLTLLCSLVPICVLRRPGANHEGSASRQKALS
1-70
LVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQITLAYKEQSGPS
70-140
PLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALRACVLVFSLALHSVFEGLAVGLQRDRARAMEL
140-210
CLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGILFSCMTPLGIGLGAALAESAGPLHQLAQSVLEGMAA
210-280
GTFLYITFLEILPQELASSEQRILKVILLLAGFALLTGLLFIQI
280-324
MGPWGEPELLVWRPEAVASEPPVPVGLEVKLGALVLLLVLTLLCSLVPICVLRRPGANHEGSASRQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALRACVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGILFSCMTPLGIGLGAALAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELASSEQRILKVILLLAGFALLTGLLFIQI