You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
FBXO34
F-box only protein 34

Protein Summary
Description
Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Members of the F-box protein family, such as FBXO34, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000313833
  • ENSP00000313159
  • ENSG00000178974
  • ENST00000440021
  • ENSP00000394117

Symbol
  • FBX34
  • Fbx34
  • CGI-301
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.91
transcription factor
0.73
tissue sample
0.65
disease perturbation
0.62
microRNA
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 103   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 103   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (33)
1 – 10 of 33
YEATS4
Tbio
Novelty: 0.0323643
p_int: 0.997517201
p_ni: 0.001215528
p_wrong: 0.00126727
Score: 0.196
Data Source: BioPlex,STRINGDB
MYO6
Tbio
Novelty: 0.01625694
p_int: 0.997403298
p_ni: 0.002596702
Score: 0.826
Data Source: BioPlex,STRINGDB
FBXO30
Tdark
Novelty: 1
p_int: 0.983580696
p_ni: 0.016419304
Score: 0.817
Data Source: BioPlex,STRINGDB
GSN
Tbio
Novelty: 0.00072379
p_int: 0.840866919
p_ni: 0.159133081
Score: 0.811
Data Source: BioPlex,STRINGDB
TMOD3
Tbio
Novelty: 0.06428995
p_int: 0.78943809
p_ni: 0.21056191
Score: 0.288
Data Source: BioPlex,STRINGDB
CUL1
Tbio
Novelty: 0.00339576
p_int: 0.77794468
p_ni: 0.22205532
Score: 0.589
Data Source: BioPlex,STRINGDB
NEXN
Tbio
Novelty: 0.00958952
p_int: 0.771522656
p_ni: 0.000066955
p_wrong: 0.228410389
Score: 0.798
Data Source: BioPlex,STRINGDB
FBXO36
Tdark
Novelty: 3
Score: 0.805
Data Source: STRINGDB
FBXO16
Tdark
Novelty: 0.68965517
Score: 0.769
Data Source: STRINGDB
FBXO28
Tbio
Novelty: 0.12833512
Score: 0.75
Data Source: STRINGDB
Publication Statistics
Amino Acid Sequence
Residue Counts
Sequence
MHLKPYWKLQKKEHPPEVSRETQRTPMNHQKAVNDETCKASHITSSVFPSASLGKASSRKPFGILSPNVL
1-70
CSMSGKSPVESSLNVKTKKNAPSATIHQGEEEGPLDIWAVVKPGNTKEKIAFFASHQCSNRIGSMKIKSS
70-140
WDIDGRATKRRKKSGDLKKAKVQVERMREVNSRCYQPEPFACGIEHCSVHYVSDSGDGVYAGRPLSVIQM
140-210
VAFLEQRASALLASCSKNCTNSPAIVRFSGQSRGVPAVSESYSAPGACEEPTERGNLEVGEPQSEPVRVL
210-280
DMVAKLESECLKRQGQREPGSLSRNNSFRRNVGRVLLANSTQADEGKTKKGVLEAPDTQVNPVGSVSVDC
280-350
GPSRADRCSPKEDQAWDGASQDCPPLPAGVSFHIDSAELEPGSQTAVKNSNRYDVEMTDELVGLPFSSHT
350-420
YSQASELPTDAVDCMSRELVSLTSRNPDQRKESLCISITVSKVDKDQPSILNSCEDPVPGMLFFLPPGQH
420-490
LSDYSQLNESTTKESSEASQLEDAAGGDSASEEKSGSAEPFVLPASSVESTLPVLEASSWKKQVSHDFLE
490-560
TRFKIQQLLEPQQYMAFLPHHIMVKIFRLLPTKSLVALKCTCCYFKFIIEYYNIRPADSRWVRDPRYRED
560-630
PCKQCKKKYVKGDVSLCRWHPKPYCQALPYGPGYWMCCHRSQKGFPGCKLGLHDNHWVPACHSFNRAIHK
630-700
KAKGTEAEEEY
700-711
MHLKPYWKLQKKEHPPEVSRETQRTPMNHQKAVNDETCKASHITSSVFPSASLGKASSRKPFGILSPNVLCSMSGKSPVESSLNVKTKKNAPSATIHQGEEEGPLDIWAVVKPGNTKEKIAFFASHQCSNRIGSMKIKSSWDIDGRATKRRKKSGDLKKAKVQVERMREVNSRCYQPEPFACGIEHCSVHYVSDSGDGVYAGRPLSVIQMVAFLEQRASALLASCSKNCTNSPAIVRFSGQSRGVPAVSESYSAPGACEEPTERGNLEVGEPQSEPVRVLDMVAKLESECLKRQGQREPGSLSRNNSFRRNVGRVLLANSTQADEGKTKKGVLEAPDTQVNPVGSVSVDCGPSRADRCSPKEDQAWDGASQDCPPLPAGVSFHIDSAELEPGSQTAVKNSNRYDVEMTDELVGLPFSSHTYSQASELPTDAVDCMSRELVSLTSRNPDQRKESLCISITVSKVDKDQPSILNSCEDPVPGMLFFLPPGQHLSDYSQLNESTTKESSEASQLEDAAGGDSASEEKSGSAEPFVLPASSVESTLPVLEASSWKKQVSHDFLETRFKIQQLLEPQQYMAFLPHHIMVKIFRLLPTKSLVALKCTCCYFKFIIEYYNIRPADSRWVRDPRYREDPCKQCKKKYVKGDVSLCRWHPKPYCQALPYGPGYWMCCHRSQKGFPGCKLGLHDNHWVPACHSFNRAIHKKAKGTEAEEEY