You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
KLHL11
Kelch-like protein 11

Protein Summary
Description
Component of a cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex that mediates the ubiquitination of target proteins, leading most often to their proteasomal degradation.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000319121
  • ENSP00000314608
  • ENSG00000178502
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.85
gene perturbation
0.68
tissue sample
0.59
histone modification site profile
0.53
tissue
0.53


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.92   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 94   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.92   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 94   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (7)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Antigen processing: Ubiquitination & Proteasome degradation
Reactome
Class I MHC mediated antigen processing & presentation
Reactome
Immune System
Reactome
Metabolism of proteins
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Antigen processing: Ubiquitination & Proteasome degradation
Class I MHC mediated antigen processing & presentation
Immune System
Metabolism of proteins
Gene Ontology Terms (2)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
Reactome
Protein-Protein Interactions (391)
1 – 10 of 391
CASQ2
Tbio
Novelty: 0.01062563
p_int: 0.999993234
p_ni: 0.000006766
Score: 0.16
Data Source: BioPlex,STRINGDB
PICK1
Tbio
Novelty: 0.00686801
p_int: 0.999992611
p_ni: 0.000007389
Data Source: BioPlex
ENDOU
Tbio
Family: Enzyme
Novelty: 0.02550401
p_int: 0.999986599
p_ni: 0.000008136
p_wrong: 0.000005265
Data Source: BioPlex
KIAA0930
Tdark
Novelty: 0.21052632
p_int: 0.999983764
p_ni: 0.000016234
p_wrong: 2e-9
Score: 0.211
Data Source: BioPlex,STRINGDB
CRABP2
Tbio
Novelty: 0.00565368
p_int: 0.999977575
p_ni: 0.000022417
p_wrong: 8e-9
Data Source: BioPlex
RHPN1
Tbio
Novelty: 0.11250959
p_int: 0.999966079
p_ni: 0.000033912
p_wrong: 9e-9
Data Source: BioPlex
IVL
Tbio
Novelty: 0.00154231
p_int: 0.99994791
p_ni: 0.00005209
Data Source: BioPlex
TYMP
Tclin
Family: Enzyme
Novelty: 0.00150895
p_int: 0.99993833
p_ni: 0.000061669
p_wrong: 1e-9
Data Source: BioPlex
CUL3
Tbio
Novelty: 0.00048264
p_int: 0.999925119
p_ni: 0.000074871
p_wrong: 1e-8
Score: 0.998
Data Source: BioPlex,STRINGDB
ANXA3
Tbio
Novelty: 0.00721351
p_int: 0.999907761
p_ni: 0.000083375
p_wrong: 0.000008864
Data Source: BioPlex
Publication Statistics
PubMed Score  0.92

PubMed score by year
PubTator Score  1.39

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAAAVAAAAAAAAAASLQVLEMESMETAAAGSAGLAAEVRGSGTVDFGPGPGISAMEASGGDPGPEAED
1-70
FECSSHCSELSWRQNEQRRQGLFCDITLCFGGAGGREFRAHRSVLAAATEYFTPLLSGQFSESRSGRVEM
70-140
RKWSSEPGPEPDTVEAVIEYMYTGRIRVSTGSVHEVLELADRFLLIRLKEFCGEFLKKKLHLSNCVAIHS
140-210
LAHMYTLSQLALKAADMIRRNFHKVIQDEEFYTLPFHLIRDWLSDLEITVDSEEVLFETVLKWVQRNAEE
210-280
RERYFEELFKLLRLSQMKPTYLTRHVKPERLVANNEVCVKLVADAVERHALRAENIQSGTCQHPTSHVSL
280-350
LPRYGQNMDVIMVIGGVSEGGDYLSECVGYFVDEDRWVNLPHIHNHLDGHAVAVTESYVYVAGSMEPGFA
350-420
KTVERYNPNLNTWEHVCSLMTRKHSFGLTEVKGKLYSIGGHGNFSPGFKDVTVYNPELDKWHNLESAPKI
420-490
LRDVKALAIEDRFVYIAARTPVDRDTEDGLKAVITCYDTETRQWQDVESLPLIDNYCFFQMSVVNSNFYQ
490-560
TASCCPKSYCLENEEAVRKIASQVSDEILESLPPEVLSIEGAAICYYKDDVFIIGGWKNSDDIDKQYRKE
560-630
AYRYCAERKRWMLLPPMPQPRCRATACHVRIPYRYLHGTQRYPMPQNLMWQKDRIRQMQEIHRHALNMRR
630-700
VPSSQIEC
700-708
MAAAAVAAAAAAAAAASLQVLEMESMETAAAGSAGLAAEVRGSGTVDFGPGPGISAMEASGGDPGPEAEDFECSSHCSELSWRQNEQRRQGLFCDITLCFGGAGGREFRAHRSVLAAATEYFTPLLSGQFSESRSGRVEMRKWSSEPGPEPDTVEAVIEYMYTGRIRVSTGSVHEVLELADRFLLIRLKEFCGEFLKKKLHLSNCVAIHSLAHMYTLSQLALKAADMIRRNFHKVIQDEEFYTLPFHLIRDWLSDLEITVDSEEVLFETVLKWVQRNAEERERYFEELFKLLRLSQMKPTYLTRHVKPERLVANNEVCVKLVADAVERHALRAENIQSGTCQHPTSHVSLLPRYGQNMDVIMVIGGVSEGGDYLSECVGYFVDEDRWVNLPHIHNHLDGHAVAVTESYVYVAGSMEPGFAKTVERYNPNLNTWEHVCSLMTRKHSFGLTEVKGKLYSIGGHGNFSPGFKDVTVYNPELDKWHNLESAPKILRDVKALAIEDRFVYIAARTPVDRDTEDGLKAVITCYDTETRQWQDVESLPLIDNYCFFQMSVVNSNFYQTASCCPKSYCLENEEAVRKIASQVSDEILESLPPEVLSIEGAAICYYKDDVFIIGGWKNSDDIDKQYRKEAYRYCAERKRWMLLPPMPQPRCRATACHVRIPYRYLHGTQRYPMPQNLMWQKDRIRQMQEIHRHALNMRRVPSSQIEC